Biochemicals and Reagents

<p>Mouse monoclonal CNDP2 antibody</p>

<p>TNF alpha antibody is a specific antibody that targets tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. This antibody is widely used in Life Sciences research to study the role of TNF-α in various biological processes. It can be used for applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Mouse monoclonal TPT1 antibody</p>

<p>The CRP antibody is a monoclonal antibody that specifically targets pancreatic glucagon and glucagon-like peptide-1 (GLP-1). It is widely used in life sciences research and assays to detect and measure the levels of these hormones. The CRP antibody has high affinity and specificity for its target, allowing for accurate and reliable results. It can be used in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. Additionally, the CRP antibody has been shown to have potential therapeutic uses in the treatment of diabetes and other metabolic disorders. With its ability to detect and quantify pancreatic hormones, this monoclonal antibody is an invaluable tool in both research and clinical settings.</p>

<p>Inhibitor of SIRT1 deacetylase</p>

<p>Purified recombinant Human CD244 protein (His tag)</p>

<p>Rabbit Polyclonal CPN2 antibody</p>

<p>Mouse lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.</p>

<p>TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN</p>

<p>cIAP1 ligand 1 is a small-molecule inhibitor, which is synthesized through organic chemistry techniques with a focus on targeting protein-protein interactions. It acts by specifically binding to the cellular inhibitor of apoptosis protein 1 (cIAP1), a member of the IAP family known for its role in regulating apoptotic pathways. The ligand's mode of action involves disrupting the interaction between cIAP1 and ubiquitin ligases, leading to the autoubiquitination and subsequent degradation of cIAP1. This destabilization results in the activation of downstream apoptotic signaling cascades, primarily through the extrinsic and intrinsic pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR40A antibody, catalog no. 70R-3536</p>

<p>Purified recombinant BGN protein (His tag)</p>

<p>Mouse monoclonal XPNPEP3 antibody</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM</p>

<p>The KLF7 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the pleomorphic adenoma gene 3 (PLAG3), which plays a crucial role in cell growth and proliferation. This antibody can be used to study the activation of epidermal growth factor receptor (EGFR) signaling pathways, as well as the regulation of mitogen-activated protein kinase (MAPK) signaling. The KLF7 antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is an essential tool for researchers studying neuronal development, cardiomyocyte differentiation, and other cellular processes. With its high specificity and reliability, the KLF7 antibody provides accurate and reproducible results in experiments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC70 antibody, catalog no. 70R-3115</p>

<p>Rabbit polyclonal RIN3 antibody</p>

<p>The CD138 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the EBNA1 protein, which is involved in glycosylation and cholinergic signaling. This antibody can be used to study the function and regulation of EBNA1, as well as its interactions with other proteins and molecules. Additionally, the CD138 antibody has been shown to inhibit interferon and interleukin-6 signaling pathways, making it a valuable tool for studying immune responses and inflammation. Its high specificity and affinity make it an ideal choice for experiments requiring accurate detection of EBNA1 or related proteins. Whether you're studying autoantibodies, plasmids, or glycation processes, the CD138 antibody is an essential reagent for your research needs.</p>

<p>Rabbit polyclonal TMS1 antibody</p>

<p>Purified recombinant UTP23 protein (His tag)</p>

<p>Purified Polyclonal ERK3 antibody</p>

<p>BDP1 antibody was raised in mouse using recombinant Human B Double Prime 1, Subunit Of Rna Polymeraseiii Transcription Initiation Factor Iiib (Bdp1)</p>

<p>Purified recombinant SEC22B protein (His tag)</p>

<p>Prepro-neuropeptide Y antibody was raised in rabbit using a synthetic Prepro-NPY 68-97 (C-PON) as the immunogen.</p>

<p>Mouse monoclonal HOXC11 antibody</p>

<p>Rabbit polyclonal MAP3K1 antibody (biotin)</p>

<p>TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV</p>

<p>Rabbit polyclonal PFN1 antibody (FITC)</p>

<p>The OSM antibody is a highly effective monoclonal antibody that specifically targets oncostatin M (OSM), a biochemical involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and potent in inhibiting the activity of OSM. It is widely used in Life Sciences research as a valuable tool for studying the role of OSM in different biological systems.</p>

<p>Purified recombinant SH3GLB1 protein</p>

<p>Rabbit polyclonal UGP2 antibody</p>

<p>Troponin I antibody (Phospho/Cardiac) was raised in mouse using a phosphorylated form of human TnC as the immunogen.</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>The VASP antibody is a highly effective monoclonal antibody that acts as an antibiotic and growth factor in various biological processes. It specifically targets the vasodilator-stimulated phosphatase (VASP), which plays a crucial role in regulating actin dynamics and cell migration. This antibody can be used for both research and diagnostic purposes, providing valuable insights into cellular signaling pathways and protein interactions.</p>

<p>Mouse monoclonal PRKAA1 antibody</p>

<p>Purified recombinant ABRACL protein (His tag)</p>

<p>KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR</p>

<p>Phenobarbital antibody was raised in mouse using phenobarbital conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal OR5V1 antibody</p>

<p>Rabbit polyclonal Synuclein gamma antibody</p>

<p>MEGVHRKPSF LALPGHLVKS EETVILQCWS DVMFEHFLLH REGKFNNTLH LIGEHHDGVS KANFSIGPMM PVLAGTYRCY GSVPHSPYQL SAPSDPLDMV IIGLYEKPSL SAQPGPTVQA GENVTLSCSS RSSYDMYHLS REGEAHERRL PAVRSINGTF QADFPLGPAT HGGTYRCFGS FRDAPYEWSN SSDPLLVSVT GN</p>

<p>Rabbit polyclonal UNC5A antibody</p>

<p>WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE</p>

<p>ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS</p>

<p>Similar to heparin, located in the extracellular matrix, the glycosaminoglycan of heparan plays important physiological roles in anticoagulation and angiogenesis. The acidic polysaccharide of heparan consists of a heterogeneous disaccharide repeating unit of hexosamine and uronic acid (L-iduronic or D-glucuronic acid) connected through 1-4 linkages and modified with various functional groups. Sulfated regions of heparan sulfate are interspaced with less or non-sulfated regions but heparin sulfate contains no non-sulfated regions.</p>

<p>CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG</p>

<p>Mouse monoclonal CD33 antibody (FITC)</p>

<p>Rabbit polyclonal SF4 antibody</p>

<p>FGD1 antibody was raised in rabbit using the C terminal of FGD1 as the immunogen</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4448</p>

<p>MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST</p>

<p>The OR1A1 antibody is a polyclonal antibody that specifically targets antiphospholipid antibodies. It has been shown to have high affinity and specificity for these autoantibodies, making it an effective tool for research and diagnostic purposes. The OR1A1 antibody can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. It has also been used to study the role of antiphospholipid antibodies in diseases such as collagen vascular diseases, thrombosis, and pregnancy complications. This antibody is produced using advanced techniques in the field of life sciences and undergoes rigorous quality control measures to ensure its performance and reliability. With its ability to detect a wide range of target antigens including alpha-fetoprotein, erythropoietin, tnf-related apoptosis-inducing ligand (TRAIL), basic protein, osteopontin, and steroids, the OR1A1 antibody is a valuable tool for researchers in</p>

<p>The SCG3 antibody is a powerful substance that inhibits the activity of specific nucleotides. This polyclonal antibody is widely used in analytical and life sciences research to study the function and interactions of various proteins and ligands. By binding to specific targets, the SCG3 antibody can effectively inhibit their activity, providing valuable insights into cellular processes and signaling pathways. With its high specificity and potency, this antibody is an essential tool for researchers seeking to understand the intricate mechanisms of protein function.</p>

<p>Region of IL16 protein corresponding to amino acids MPDLNSSTDS AASASAASDV SVESTAEATV CTVTLEKMSA GLGFSLEGGK GSLHGDKPLT INRIFKGAAS EQSETVQPGD EILQLGGTAM QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKETTAAGDS.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2S2 antibody, catalog no. 70R-4905</p>

<p>SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY</p>

<p>PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV</p>

<p>ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA</p>

<p>Purified Polyclonal ERAS antibody</p>

<p>Sheep polyclonal Zaleplon antibody</p>

<p>ST6GALNAC6 antibody was raised using the C terminal of ST6GALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP</p>

<p>Rabbit polyclonal Synapsin1 antibody</p>

<p>Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL</p>

<p>The CRYAB antibody is a monoclonal antibody that specifically targets the colony-stimulating factor known as GM-CSF. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It acts by neutralizing the activity of GM-CSF, which is responsible for promoting the growth and activation of various immune cells.</p>

<p>Rat monoclonal CIRE antibody (FITC)</p>

<p>UCP4 antibody was raised in rabbit using a 16 amino acid peptide from human UCP4 as the immunogen.</p>

<p>The OTX2 antibody is a highly specialized monoclonal antibody that targets a specific molecule involved in growth factor signaling. It is widely used in Life Sciences research for its neutralizing properties and ability to block the activity of this target molecule. This antibody has been extensively studied and proven to be effective in inhibiting the function of the target molecule, leading to important discoveries in various fields of research.</p>

<p>Horse RBC antibody was raised in rabbit using equine erythrocytes as the immunogen.</p>

<p>The CD49f antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that exhibits both antiangiogenic and cytotoxic properties. This antibody specifically targets and binds to CD49f, which is an activated growth factor receptor found on the surface of cells. By binding to CD49f, the antibody inhibits the signaling pathway that promotes angiogenesis and cell growth.</p>

<p>Mouse monoclonal Pyruvate Dehydrogenase antibody (C-terminus)</p>

<p>Rabbit polyclonal SERPINB9 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC8B antibody, catalog no. 70R-6538</p>

<p>The TRPV3 antibody is a highly specialized antibody that targets the cation channel TRPV3. This antibody has been extensively studied and proven to be effective in various applications. It can be used as a colloidal or cross-linking agent in experiments involving TNF-α activation. The TRPV3 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.</p>

<p>TOX antibody was raised in rabbit using the N terminal of TOX as the immunogen</p>

<p>KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM55D antibody, catalog no. 70R-1827</p>

<p>Purified Polyclonal BTF3L4 antibody</p>

<p>Rabbit polyclonal SS18L2 antibody</p>

<p>Giredestrant is a synthetic peptide that can be used as a research tool in pharmacology and cell biology. Giredestrant binds to the acetylcholine receptor, blocking its ability to respond to acetylcholine. Giredestrant also inhibits protein interactions with ion channels and ligand-gated ion channels, which are important for the transmission of nerve impulses. The high purity of this reagent makes it suitable for use in cell biology research.</p>

<p>TBC1D10C antibody was raised using the N terminal of TBC1D10C corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP</p>

<p>ADRA1B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE</p>

<p>Purified recombinant Human ADPRHL2 protein (His tag)</p>

<p>GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV</p>

<p>Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG</p>

<p>The SH3BP5 antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets and binds to SH3BP5, an important protein involved in various cellular processes. This antibody has been extensively studied for its role in interferon signaling and apoptosis induction.</p>

<p>Purified Polyclonal FR gamma antibody</p>

<p>Rabbit polyclonal TrkB antibody (Tyr706+Tyr707)</p>

<p>The LTA4H antibody is a highly effective test substance used in various applications such as electrophoresis, erythropoietin analysis, and phalloidin staining. This antibody specifically targets LTA4H, an enzyme involved in the synthesis of leukotriene B4 (LTB4), which plays a crucial role in inflammation and immune response. The LTA4H antibody is widely used in the field of Life Sciences for research purposes, including the study of actin filaments, growth factors, chemokines, and monoclonal antibodies. It is also utilized as a neutralizing agent or medicament for therapeutic applications. With its high specificity and reliability, the LTA4H antibody is an essential tool for scientists and researchers in their pursuit of understanding complex biological processes.</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>The HSP90AB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the HSP90AB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>SF4 antibody was raised in rabbit using the C terminal of SF4 as the immunogen</p>

<p>MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH</p>

<p>ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET</p>

<p>RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD</p>

<p>Purified native Adenovirus protein (Mouse)</p>