Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,127 products)
- By Biological Target(99,160 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,742 products)
- Secondary Metabolites(14,222 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LCBiot-FPWFPLPSPYGN-OH
<p>Peptide LCBiot-FPWFPLPSPYGN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cortisol antibody
<p>Cortisol antibody is a highly specific monoclonal antibody that targets cortisol, a steroid hormone involved in stress response and regulation of various physiological processes. This antibody can be used in research and diagnostic applications to detect and quantify cortisol levels in biological samples. It has been extensively validated for its high sensitivity and specificity, ensuring accurate and reliable results. The Cortisol antibody is produced using advanced techniques, including interferon activation and colloidal gold conjugation, resulting in a high-quality product with excellent performance characteristics. Whether you're studying the role of cortisol in stress-related disorders or developing diagnostic assays for hormonal imbalances, this Cortisol antibody is an essential tool for life sciences research.</p>Cytokeratin 19 antibody
<p>Cytokeratin 19 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to target and bind to histidine residues on the MERTK protein, effectively neutralizing its activity. The antibody has been extensively tested and validated for use in various applications including immunofluorescence (IF), immunohistochemistry (IHC), and western blotting (WB). It exhibits high specificity and sensitivity, making it an ideal choice for researchers studying MERTK signaling pathways.</p>H-DTLYITR^-OH
<p>Peptide H-DTLYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVLAFGFAL-OH
<p>H-NVLAFGFAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NVLAFGFAL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NVLAFGFAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NVLAFGFAL-OH at the technical inquiry form on this page</p>Purity:Min. 95%HIV - 1 MN ENV - 10
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,727 g/molH-AADDTWEPFASGK^-OH
<p>Peptide H-AADDTWEPFASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Prolactin antibody (HRP)
<p>Prolactin antibody (HRP) was raised in mouse using human prolactin as the immunogen.</p>Goat anti Cat IgG (H + L) (FITC)
<p>Goat anti-cat IgG (H+L) (FITC) was raised in goat using feline IgG whole molecule as the immunogen.</p>Purity:Min. 95%Ac-SSVFAQ-OH
<p>Peptide Ac-SSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEPVSPPR^-OH
<p>Peptide H-SEPVSPPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AL^PAPIEK-OH
<p>Peptide H-AL^PAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDSILAVR^-OH
<p>Peptide H-EDSILAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 31
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,507.6 g/molH-SPDFTNENPLETR^-OH
<p>Peptide H-SPDFTNENPLETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPSWEPFR^-OH
<p>Peptide H-SPSWEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLL^MWITQC-OH
<p>Peptide H-SLL^MWITQC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α 1 Antitrypsin antibody
<p>Alpha 1 antitrypsin antibody was raised in sheep using human alpha 1 antitrypsin purified from plasma as the immunogen.</p>Purity:Min. 95%Gastrin Releasing Peptide, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C130H204N38O31S2Molecular weight:2,859.4 g/molH-DSSEEK^-OH
<p>Peptide H-DSSEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISEQTYQLSR^-OH
<p>Peptide H-ISEQTYQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 56
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,566.7 g/molH-SFFSFLGEAFDGAR^-OH
<p>Peptide H-SFFSFLGEAFDGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza A antibody
<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>HIV - 1 MN ENV - 143
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,696.1 g/molH-TTPPVLDSDGSFFLYSK-OH
<p>Peptide H-TTPPVLDSDGSFFLYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-YLGR-OH
<p>Peptide Ac-YLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NMDAR1 antibody
<p>The NMDAR1 antibody is a monoclonal antibody that specifically targets the N-methyl-D-aspartate receptor 1 (NMDAR1). This receptor plays a crucial role in synaptic plasticity and learning. The NMDAR1 antibody has been extensively studied and shown to have neutralizing properties against NMDAR1, preventing its activation by glutamate. This antibody has also been found to be effective in inhibiting the growth of Cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. Additionally, the NMDAR1 antibody has potential therapeutic applications in the treatment of conditions such as insulin resistance, as it can modulate insulin signaling pathways. It is also being investigated for its potential role in regulating natriuretic peptide levels and as a growth factor for certain cell types. With its ability to target specific receptors and modulate various biological processes, the NMDAR1 antibody holds great promise in both research and therapeutic applications.</p>Insulin+Proinsulin antibody
<p>Insulin/proinsulin antibody was raised in mouse using purified mouse Insulin and proinsulin as the immunogen.</p>Prolactin antibody
<p>Prolactin antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to prolactin, a hormone involved in various physiological processes. This antibody can be used in experiments to study the role of prolactin in different cell types, such as granulosa cells. The antibody forms a complex with prolactin, allowing researchers to detect and measure the levels of prolactin in samples using techniques like ELISA or Western blotting. Additionally, this monoclonal antibody has neutralizing properties, meaning it can inhibit the biological activity of prolactin. The Prolactin antibody is an essential tool for scientists investigating the functions and mechanisms of this important hormone.</p>H-GYAPLMETGLSSKRY-OH
<p>H-GYAPLMETGLSSKRY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GYAPLMETGLSSKRY-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GYAPLMETGLSSKRY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GYAPLMETGLSSKRY-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CR-NH2
<p>Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Epothilone D (synthetic)
CAS:<p>Microtubule stabilizer; natural polyketide compound; antineoplastic</p>Formula:C27H41NO5SPurity:Min. 95%Color and Shape:PowderMolecular weight:491.69 g/molH-MGKLSKIWDLPL^DE-OH
<p>Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDVRLQDAGVYCCLIGYG-NH2
<p>H-TDVRLQDAGVYCCLIGYG-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TDVRLQDAGVYCCLIGYG-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TDVRLQDAGVYCCLIGYG-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TDVRLQDAGVYCCLIGYG-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Salmonella antibody
<p>Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.</p>CYP1A1 antibody
<p>CYP1A1 antibody was raised in mouse using partially purified P450 1A1 induced rat liver microsomes as the immunogen.</p>Purity:Min. 95%Histone H3 (1-34)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C144H260N54O44Molecular weight:3,451.98 g/molH-NPANPV^QR-OH
<p>Peptide H-NPANPV^QR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Eledoisin
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C54H85N13O15SMolecular weight:1,181.41 g/molLCBiot-MGSSHHHHHHSSGLVPRGSH-OH
Peptide LCBiot-MGSSHHHHHHSSGLVPRGSH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KKSL-OH
<p>Peptide Aoa-KKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Goat anti Human IgA
<p>Goat anti-human IgA was raised in goat using purified human IgA as the immunogen.</p>Purity:Min. 95%Ac-AVAGCAGAR-OH
<p>Peptide Ac-AVAGCAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNSLSEL^EVK-OH
<p>Peptide H-NLNSLSEL^EVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGAVGVGK^-OH
<p>Peptide H-VVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSGSSLIR^-OH
<p>Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HSV1 gG antibody
<p>HSV1 gG antibody was raised in mouse using herpes simplex virus I glycoprotein G (gG) as the immunogen.</p>Dimenhydrinate - Bio-X ™
CAS:Controlled Product<p>Dimenhydrinate is a drug that was initially used as an antihistamine to treat symptoms of allergies such as watery eyes, sneezing and a runny nose, however it is now used for the treatment and prevention of nausea, vertigo and motion sickness. Dimenhydrinate is a combination of diphenhydramine and 8-chlorotheophylline. Its antiemetic properties are thought to be produced from diphenhydramine’s antagonism of H1 histamine receptors. Also, it is believed to have antimuscarinic effects that minimize disturbances to the body’s equilibrium.</p>Formula:C24H28ClN5O3Purity:Min. 95%Color and Shape:PowderMolecular weight:469.96 g/molH-LNVQGDTK^-OH
<p>Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LDHA antibody
<p>LDHA antibody was raised in mouse using recombinant human LDHA (1-332aa) purified from E.coli as the immunogen.</p>H-IGSLDNITHVPGGGNK^-OH
<p>Peptide H-IGSLDNITHVPGGGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Peanut Conglutin Mouse Monoclonal Antibody
<p>Peanut Conglutin Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Peanut Conglutin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Von Willebrand Positive Human Plasma
<p>Von Willebrand Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Von Willebrand Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Ac-HWRGWVC-OH
<p>Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STRDPLSEITK^-OH
<p>Peptide H-STRDPLSEITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FLAG peptide acetate salt
CAS:<p>FLAG peptide</p>Formula:C41H60N10O20Purity:Min. 95%Molecular weight:1,012.9 g/molNeurofilament Light Chain (NfL) Monoclonal Antibody
<p>Neurofilament Light Chain (NfL) Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neurofilament Light Chain (NfL) Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Diphenylhydantoin antibody
<p>The Diphenylhydantoin antibody is a powerful monoclonal antibody that targets multidrug resistance in cancer cells. It specifically binds to diphenylhydantoin, a commonly used antiepileptic drug, and blocks its efflux from cancer cells. This antibody has shown promising results in increasing the efficacy of chemotherapy by reversing drug resistance.</p>Purity:Min. 95%Tetrabenazine - Bio-X ™
CAS:Controlled Product<p>Tetrabenazine is a drug that has been used for the treatment of Parkinson's disease. It acts by inhibiting dopamine release and reducing the activity of nerve cells in the brain. Tetrabenazine Bio-X is used to treat dyskinesias, that are abnormal and involuntary muscle movements by inhibiting the monoamine transporter (VMAT2).<br>Tetrabenazine is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use."</p>Formula:C19H27NO3Purity:Min. 99 Area-%Color and Shape:White PowderMolecular weight:317.42 g/molH-CKALKSGKIEGEDRK-NH2
<p>Peptide H-CKALKSGKIEGEDRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAVYQAGAR^-OH
<p>Peptide H-LAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CS-NH2
<p>Peptide Ac-CS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEEVSLRK^-OH
<p>Peptide H-AVEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTEHDTLLY-NH2
<p>Peptide H-VTEHDTLLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Diclofenac sodium salt - Bio-X ™
CAS:<p>Diclofenac is a non-steroidal anti-inflammatory drug that is used to treat the signs and symptoms of arthritis and osteoarthritis. This drug inhibits COX-1 and COX-2 enzymes. As a result, it reduces pain and inflammation in joints. Diclofenac is usually used as a first line therapy for acute and chronic pain.</p>Formula:C14H11NO2Cl2•NaPurity:Min. 95%Color and Shape:PowderMolecular weight:319.14 g/molH-VVLAYEPVWAIGTGK^-OH
<p>Peptide H-VVLAYEPVWAIGTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Methamphetamine antibody
<p>Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.</p>Tizanidine HCl - Bio-X ™
CAS:<p>Tizanidine is an alpha-2 adrenergic agonist drug that is used in the treatment of muscle spasticity. This drug binds to alpha-2 adrenergic receptors and causes presynaptic inhibition of motor neurons. Additionally, it leads to a reduction in the release of amino acids such as glutamate and aspartate which have an excitatory effect.</p>Formula:C9H9Cl2N5SPurity:Min. 95%Color and Shape:PowderMolecular weight:290.17 g/molHXB2 gag NO-99/aa393 - 407
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,663.9 g/molGP120 - W61D - 57
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,621.9 g/molAc-ARPLEQAVAAIV-NH2
<p>Peptide Ac-ARPLEQAVAAIV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CEA protein
<p>CEA protein is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a glycoprotein expressed in various types of cancer cells. This antibody specifically binds to CEA, inhibiting its function and promoting immune-mediated cytotoxicity against cancer cells. In addition, CEA protein has been shown to have cardioprotective effects by modulating protein kinase signaling pathways in cardiomyocytes. This versatile antibody is widely used in Life Sciences research for applications such as immunohistochemistry, flow cytometry, and Western blotting. With its high specificity and affinity for CEA, CEA protein offers a valuable tool for studying cancer biology and developing targeted therapies.</p>Purity:Min. 95%DHEA antibody
<p>The DHEA antibody is a polyclonal antibody that is used for the quantitation and detection of dehydroepiandrosterone (DHEA) in various biological samples. The DHEA antibody was raised in sheep using DHEA(17)-BTG as the immunogen. Supplied at 10mg/ml, a matched pair conjugate is available for DHEA antibody: 80-1055</p>Purity:Min. 95%Ac-KTEEISEVNLDAEF-NH2
<p>Peptide Ac-KTEEISEVNLDAEF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dabcyl-SFNFPQIT-Edans
<p>Peptide Dabcyl-SFNFPQIT-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALYVDSLFF^L-OH
<p>Peptide H-ALYVDSLFF^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENLQFSAAL^R-OH
<p>Peptide H-ENLQFSAAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVHIDVIK^-OH
<p>Peptide H-LVHIDVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSQTVTSGGGTSATASSK-OH
<p>H-GLSQTVTSGGGTSATASSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLSQTVTSGGGTSATASSK-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLSQTVTSGGGTSATASSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLSQTVTSGGGTSATASSK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-TEGDGV^YTLNDK^-OH
<p>Peptide H-TEGDGV^YTLNDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SCO2 antibody
<p>The SCO2 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a nuclear receptor and is involved in insulin signaling, anti-HER2 antibody response, endothelial growth, and more. This polyclonal antibody is widely used in life sciences research to study the functions and interactions of proteins related to insulin, epidermal growth factor, dopamine, thymidylate, and natriuretic factors.</p>ApoB antibody
<p>ApoB antibody was raised in sheep using apolipoprotein B purified from human plasma as the immunogen.</p>Purity:Min. 95%H-ICLDLQAPLYK^-OH
<p>Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^TSAVLQ-OH
<p>Peptide H-K^TSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VRT 043198
CAS:<p>An inhibitor of caspase-1 and active metabolite of VX-765. Blocks lipopolysaccharide-mediated release of cytokines. Suppresses release of interleukins IL-1β and IL-18. Reduced inflammatory cytokines, such as IL-1α, tumor necrosis factor-α, IL-6 and IL-8, observed in in vivo models of rheumatoid arthritis and skin inflammation.</p>Formula:C22H29ClN4O6Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:480.94 g/molCKMB protein
<p>CKMB protein is a glycoprotein that plays a crucial role in the diagnosis of myocardial infarction. It is a monoclonal antibody that specifically targets the CK-MB isoform, which is predominantly found in cardiac muscle tissue. This protein can be used in various applications, including immunoassays and diagnostic tests for the early detection of heart-related diseases. The CKMB protein has high affinity and specificity for CK-MB, making it an ideal tool for accurate and reliable measurements. It can be conjugated with different labels, such as enzymes or fluorescent dyes, to enable easy detection and quantification. Additionally, this protein can be used in combination with other biomarkers to enhance diagnostic accuracy. In the field of life sciences and research, CKMB protein is widely used for studying the mechanisms of cardiac diseases and evaluating the efficacy of potential therapeutic interventions. Its ability to specifically bind to CK-MB allows researchers to investigate its role in various physiological and pathological processes. Overall, CKMB</p>Purity:Min. 95%Fmoc-Cys-OH
<p>Peptide Fmoc-Cys-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQASALAAWGGK^-OH
<p>Peptide H-ALQASALAAWGGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Heartworm antibody
<p>Heartworm antibody was raised in rabbit using dirofilaria immitis as the immunogen.</p>H-LLIGCWYCRRRNGYR-OH
<p>H-LLIGCWYCRRRNGYR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLIGCWYCRRRNGYR-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLIGCWYCRRRNGYR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLIGCWYCRRRNGYR-OH at the technical inquiry form on this page</p>Purity:Min. 95%PSA antibody
<p>PSA antibody is a highly specialized product used in Life Sciences research. It is an ultrasensitive detection tool that utilizes electrochemical impedance spectroscopy to detect and measure the levels of prostate-specific antigen (PSA) in biological samples. The PSA antibody is immobilized on a carbon electrode, allowing for the specific binding of PSA molecules present in the sample. This interaction generates an electrical signal, which can be measured and analyzed to determine the concentration of PSA. The use of this monoclonal antibody-based assay provides accurate and reliable results, making it an essential tool for researchers studying prostate cancer and other related diseases.</p>H-FQDGDLTLYQSNTILR^-OH
<p>Peptide H-FQDGDLTLYQSNTILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IGF1 antibody
<p>IGF1 antibody was raised in goat using highly pure recombinant murine IGF-I as the immunogen.</p>Purity:Min. 95%Gastrin I, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C97H125N20O31SMolecular weight:2,098.22 g/molLCBiot-HASARQQWEL-OH
<p>Peptide LCBiot-HASARQQWEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Troponin I antibody (Skeletal Muscle)
<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>SIVmac239 - 92
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,565.9 g/molCRP antibody
<p>CRP antibody was raised in goat using Purified human CRP as the immunogen.<br>C-Reactive Protein (CRP) is an acute-phase inflammatory, pentameric plasma protein. Awarded its name after being first discovered reacting with the capsular (C)-polysaccharide of the Pneumococcus infection, CRP has since been found to activate the classical complement pathway of innate immunity. Dependent on the presence of calcium ions on its ligand-binding face, CRP specifically stimulates C1q when binding to phosphocholine and other polysaccharides located on microorganisms. Expression of CRP is increased (primarily in the hepatocytes) when inflammatory cytokines such as interleukin-6 are elevated during infection and some conditions such as rheumatoid arthritis and cardiovascular diseases.</p>gp100 (457-466)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C47H85N13O15Molecular weight:1,072.28 g/molNS2(114 - 121), Influenza
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C48H74N12O12Molecular weight:1,011.2 g/molH-SYSMEHFRWGKPV-NH2
<p>Peptide H-SYSMEHFRWGKPV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EILDAFDK^-OH
<p>Peptide H-EILDAFDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ApoB antibody
<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>Purity:Min. 95%H-RIFSTDTGPGGC-Clear-Base Resin
<p>Peptide H-RIFSTDTGPGGC-Clear-Base Resin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza HA (204 - 212)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C49H73N11O15Molecular weight:1,056.19 g/molMumps virus protein
<p>Mumps virus protein is a chemokine that plays a crucial role in various biological processes. It contains tyrosine residues that are essential for its function, including the activation of caspase-9 and inhibition of EGFR protein. This protein also stimulates endothelial growth and has been found to interact with epidermal growth factor. Native Proteins & Antigens offers monoclonal antibodies specifically designed to target this protein, making it an invaluable tool for research in the field of life sciences. These antibodies have shown neutralizing activity against mumps virus, providing valuable insights into the mechanisms of viral infection and potential therapeutic interventions.</p>Purity:Min. 95%H-LVESLPQEIK^-OH
<p>Peptide H-LVESLPQEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSHGTPSQTTAKNWE-OH
<p>H-SSHGTPSQTTAKNWE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SSHGTPSQTTAKNWE-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SSHGTPSQTTAKNWE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SSHGTPSQTTAKNWE-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-TSAVLQSGFRK-NH2
<p>Peptide H-TSAVLQSGFRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHGLEIEGR^-OH
<p>Peptide H-VHGLEIEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APLQGTLLGYR^-OH
<p>Peptide H-APLQGTLLGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STQAAIDQI^NGK-OH
<p>Peptide H-STQAAIDQI^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Copanlisib
CAS:<p>Class 1 PI3K enzyme inhibitor; anti-neoplastic</p>Formula:C23H28N8O4Purity:Min. 95%Color and Shape:SolidMolecular weight:480.52 g/molMethyltetrazine-GLFDIIKKIAESF-OH
<p>Peptide Methyltetrazine-GLFDIIKKIAESF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-CoV-2 Positive Human Nasal Swab (Dry)
<p>SARS-CoV-2 Positive Human Nasal Swab (Dry) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2 Positive Human Nasal Swab (Dry) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-VSTLPAITLK^-OH
<p>Peptide H-VSTLPAITLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ketoprofen - Bio-X ™
CAS:<p>Ketoprofen is a non-steroidal anti-inflammatory drug (NSAID) that has been used to treat pain and inflammation. Ketoprofen inhibits the production of inflammatory prostaglandins, which are released by platelets in response to injury or infection. The main mechanism of action is inhibition of cyclooxygenase enzymes COX 1 and COX 2 at the level of transcriptional activation. This results in decreased levels of prostaglandins that mediate pain, fever and inflammation.</p>Formula:C16H14O3Purity:Min. 95%Color and Shape:PowderMolecular weight:254.28 g/molGoat anti Human IgG (H + L) (rhodamine)
<p>Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>Purity:Min. 95%H-QLLAPGNSAGAFLIR^-OH
<p>Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PKI 587
CAS:<p>PI3K/mTOR kinase inhibitor; anti-neoplastic</p>Formula:C32H41N9O4Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:615.73 g/molH-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Oseltamivir phosphate - Bio-X ™
CAS:Controlled Product<p>Oseltamivir is a neuraminidase inhibitor that is used to treat influenza. It is an antiviral drug that is an inhibitor of influenza virus neuraminidase enzymes. This drug reduces viral infectivity and shedding.</p>Formula:C16H31N2O8PPurity:Min. 95%Color and Shape:PowderMolecular weight:410.4 g/molLCBiot-KNIVTPRTPPPSQGK-NH2
<p>Peptide LCBiot-KNIVTPRTPPPSQGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLAEVATGEK^-OH
<p>Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GQLIDSMANSFVGTR-NH2
<p>Peptide Ac-GQLIDSMANSFVGTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CA 15-3 (Low Cross-reactivity), Part Purified
<p>CA 15-3 (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Purity:Specificationβ-Amyloid (1-40)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C194H295N53O58S1Molecular weight:4,329.86 g/molHSV2 protein
<p>The HSV2 protein is a cytotoxic phosphatase that falls under the category of Native Proteins & Antigens. It has been widely studied in the field of Life Sciences for its role in various cellular processes. HSV2 protein has been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α) and chemokines, making it a potential target for the development of inhibitors. Additionally, this protein has been used in research involving tyrosine kinase receptors and antibody-drug conjugates. Monoclonal antibodies targeting HSV2 protein have been developed, such as imatinib, which can bind to specific binding proteins and exert therapeutic effects. Researchers have also explored the use of HSV2 protein as a tool in the development of new drugs and therapies.</p>Purity:Min. 95%H-VPEPCQPK^-OH
<p>Peptide H-VPEPCQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Streptavidin Poly-HRP80 Conjugate
<p>Streptavidin Poly-HRP80 Conjugate (diluted to 50 µg/ml in stabilizer 85R-104).</p>Purity:Min. 95%SIVmac239 - 53
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,703.8 g/molH-IHWESASLLR^-OH
<p>Peptide H-IHWESASLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SDKNEKSHKYETLNISKC-NH2
<p>Peptide Ac-SDKNEKSHKYETLNISKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FATVEVTDK^-OH
<p>Peptide H-FATVEVTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myoglobin antibody
<p>Myoglobin antibody was raised in mouse using human heart myoglobin as the immunogen.</p>Purity:Recommended For Cardiac Myoglobin Immunoassay. Use Cat# 10-M50C CloneH-IWLDNVR^-OH
<p>Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-97/aa385 - 399
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,724.1 g/molAc-GEGQQHHLGGAKQAGDV-OH
<p>Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-REEE-NH2
<p>Peptide Ac-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ART558
CAS:<p>ART558 is a potent inhibitor of kinases, specifically targeting cyclin-dependent kinases (CDKs). It has been extensively studied for its potential use in cancer treatment. ART558 works by inhibiting the activity of CDKs, which are proteins that regulate cell division and growth. This inhibition leads to apoptosis, or programmed cell death, in cancer cells. ART558 has shown promising results in preclinical studies against a variety of human cancers, including lung and breast tumors. Additionally, it has been found to be effective against Chinese hamster ovary cells and other tumor cells. ART558 is being developed as an anticancer drug candidate due to its medicinal properties and potential as a targeted therapy for cancer patients.</p>Formula:C21H21F3N4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:418.4 g/molCMVpp65 - 20 (VQHTYFTGSEVENVS)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,696.8 g/molH-Orn-Hyp-Myristoil2 · 2HCl
<p>Please enquire for more information about H-Orn-Hyp-Myristoil2 · 2HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H78N4O4Cl2Purity:Min. 95%Molecular weight:723.96 g/molAc-CEQKLISEEDL-NH2
<p>Peptide Ac-CEQKLISEEDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEPEK^-OH
<p>Peptide H-NEPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Azide-IELLQARC-OH
<p>Peptide Azide-IELLQARC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Valacyclovir hydrochloride dihydrate
CAS:<p>Valacyclovir hydrochloride is an analog of the antiviral drug acyclovir that is used to treat herpes simplex virus infections. However, recent studies have shown that it may also have potential as an anticancer agent. Valacyclovir hydrochloride has been found to inhibit protein kinases, which are enzymes that play a key role in tumor growth and progression. In particular, it has been shown to inhibit the activity of several kinases involved in cancer cell proliferation and survival. This inhibition leads to apoptosis, or programmed cell death, which can help slow or stop tumor growth. Valacyclovir hydrochloride has also been studied for its medicinal properties in Chinese traditional medicine, where it is believed to have anti-inflammatory and immune-boosting effects. Additionally, valacyclovir hydrochloride is excreted unchanged in urine and may act as a potent inhibitor of viral DNA polymerase in humans.</p>Formula:C13H20N6O4•HCl•(H2O)2Purity:Min. 95%Molecular weight:396.83 g/molFS1 peptide
<p>FS1, a synthetic BH3 peptide used in BH3 profiling, shows promise in enhancing Natural Killer (NK) cell-mediated cancer therapy. By selectively targeting anti-apoptotic BCL-2 family proteins, FS1 can trigger cytochrome c release in sensitive cancer cell lines, promoting apoptosis. This mechanism synergizes with NK cell activity, leading to increased cancer cell death both in vitro and in vivo. Therefore, FS1 represents a potential therapeutic agent for enhancing NK cell-based immunotherapy approaches.</p>CMVpp65 - 16 (YTPDSTPCHRGDNQL)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,703.8 g/molCYC 116
CAS:<p>Aurora kinase inhibitor</p>Formula:C18H20N6OSPurity:Min. 95%Molecular weight:368.14193Neuropeptide K
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C175H284N52O52SMolecular weight:3,980.4 g/molNangibotide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C54H82N14O22S2Molecular weight:1,343.44 g/molH-YGIDWASGR^-OH
<p>Peptide H-YGIDWASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QKSDDDYEDYASNKTC-NH2
<p>Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hemoglobin protein
<p>Haemoglobin protein is a vital protein complex found in red blood cells that plays a crucial role in carrying oxygen throughout the body. It is classified under Native Proteins & Antigens and is involved in various biological processes. Haemoglobin has the ability to bind with oxygen, ensuring its transportation from the lungs to different tissues and organs. Additionally, it can also bind with carbon dioxide, aiding in its removal from the body.</p>Purity:>95% As Determined By Sds-Page.Ac-MYWVRQAPGKGLEW-NH2
<p>Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEVSSPYFK^-OH
<p>Peptide H-YEVSSPYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 19 (NQLQVQHTYFTGSEV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,750.9 g/molBendamustine HCl - Bio-X ™
CAS:<p>Bendamustine is a bifunctional mechlorethamine derivative with alkylator and antimetabolite properties. An alkylating group, a benzimidazole ring that may function as a purine analog, and a butyric acid side chain are the three active moieties found in bendamustine. Through its function as an alkylating agent, Bendamustine causes intra and inter-strand crosslinks between DNA bases resulting in DNA, RNA synthesis inhibition and cell death.</p>Formula:C16H21Cl2N3O2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:394.72 g/molMca-Pro-Leu-OH
CAS:<p>Mca-Pro-Leu-OH is a monoclonal antibody that recognizes the antigen staphylococcus. It is useful for the diagnosis of postoperative infections, nephrology dialysis, and in renal transplantation to prevent graft rejection. It has been used as an immunofluorescent stain in human chorionic gonadotropin (hCG) and follicle stimulating hormone (FSH) studies. Mca-Pro-Leu-OH is a mouse monoclonal antibody that reacts with human chorionic gonadotropin (hCG). The specificity of this antibody has been shown to be very high since it does not react with other proteins found in nature such as follicle stimulating hormone (FSH).</p>Formula:C23H28N2O7Purity:Min. 95%Color and Shape:PowderMolecular weight:444.48 g/molH-TDELFQIEGLKEELAYLR^-OH
<p>Peptide H-TDELFQIEGLKEELAYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NBQX disodium salt - Bio-X ™
CAS:<p>NBQX is a competitive antagonist of ionotropic glutamate receptors of AMPA and kainate subfamilies. It has been reported anti-convulsant activity in seizures models induced by electrostimulation, drugs or genetic predisposition.</p>Formula:C12H6N4Na2O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:380.24 g/molHPV 33 E6 64-72 (HLA-A*03:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>SARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C97H144N22O30Molecular weight:2,098.43 g/molH-YTDV^SNMSHLA-OH
<p>Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IDEALER^-OH
<p>Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CRAELEKHGYKMETS
<p>Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-OH
<p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C190H288N54O57Molecular weight:4,240.7 g/molAoa-KRRGSTCVLA-NH2
<p>Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Norovirus antibody
<p>Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.</p>H-DLSLEEIQK^-OH
<p>Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIAFSR^-OH
<p>Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>9-(4-Chlorobenzyl)-6- methoxy-1-methyl-4,9-dihydro-3H-pyrido[3,4-b]indol
CAS:<p>novel tricyclic indole; promising new treatment for a variety of diseases</p>Formula:C20H19ClN2OPurity:Min. 99 Area-%Color and Shape:Slightly Brown PowderMolecular weight:338.83 g/molH-EGYLQIGANTQAAQK^-OH
<p>Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MTATHAVDEAVS-NH2
<p>Peptide Ac-MTATHAVDEAVS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVTVDTTLAGYHLPK^-OH
<p>Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-HHHHH-OH
<p>Peptide Aoa-HHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFDQIDNAPEEK^-OH
<p>Peptide H-AFDQIDNAPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVY^FCHLDIIW^-OH
<p>H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C109H163N25O32S5Molecular weight:2,495.97 g/molH-GPEQTQGNFGDQELIR^-OH
<p>Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AASLDGFYNGR^-OH
<p>Peptide H-AASLDGFYNGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RFGRFLRKILRFLKK-NH2
<p>Peptide Ac-RFGRFLRKILRFLKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFPHFDVSHGSAQVK^-OH
<p>Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTPVGR^-OH
<p>Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block for the synthesis of peptides. It is a resin that contains amines, thiols, and alcohols. The resin has a particle size of 100 to 200 mesh and contains 1% DVB.</p>Purity:Min. 95%Exendin-4
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C184H282N50O60SMolecular weight:4,186.7 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
<p>H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C192H295N61O60SMolecular weight:4,449.9 g/mol
