Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,678 products)
- By Biological Target(100,149 products)
- By Pharmacological Effects(6,845 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,910 products)
- Secondary Metabolites(14,344 products)
Found 130210 products of "Biochemicals and Reagents"
Transferrin protein (Holo)
Purified native Human Transferrin protein (Holo)Purity:≥98% By Sds-Page And Cellulose Acetate ElectrophoresisWKYMVdM TRIFLUOROACETATE
CAS:Please enquire for more information about WKYMVdM TRIFLUOROACETATE including the price, delivery time and more detailed product information at the technical inquiry form on this page
Tandospirone
CAS:Tandospirone is a psychotropic drug that acts as a selective serotonin receptor partial agonist. It is derived from a synthetic source, specifically targeting the 5-HT1A receptors in the brain. Tandospirone modulates serotonergic neurotransmission by binding to these receptors, which are associated with mood regulation. This action results in the anxiolytic and antidepressant effects observed with the drug.Formula:C21H29N5O2Purity:Min. 95%Molecular weight:383.49 g/molNormal Horse Serum
Normal Horse Serum is a high-quality serum that is widely used in the Life Sciences industry. It is activated and neutralizing, making it an excellent choice for various applications. This serum is proteolytic and contains cellulose, which ensures stability and longevity. Normal Horse Serum is commonly used in the production of monoclonal antibodies, as well as in Biospecimens, Serum, Plasma & Other Fluids research. It has been shown to effectively neutralize oncostatin and autoantibodies, making it a valuable tool in many experimental setups. With its colloidal properties and emission capabilities, Normal Horse Serum is also frequently utilized in Veterinary Applications. Choose Normal Horse Serum for reliable results and consistent performance.Purity:Min. 95%Prothrombin protein
Prothrombin protein is a multifunctional chemokine that plays a crucial role in the blood clotting process. It is activated by various factors, including annexin and reactive oxygen species. In the field of Life Sciences, prothrombin protein is widely used as an anticoagulant and growth factor. Native Proteins & Antigens offers high-quality prothrombin protein for research purposes.Purity:>98% By Sds-Page.AMG 487 - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C32H28F3N5O4Purity:Min. 95%Color and Shape:PowderMolecular weight:603.59 g/molPhosphoserine antibody
Phosphoserine antibody was raised in rabbit using phosphoserine-KLH and phosvitin mixture as the immunogen.Purity:Min. 95%3-Deazaneplanocin hydrochloride - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C12H14N4O3•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:298.73 g/molSn(IV) mesoporphyrin IX dichloride - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C34H36Cl2N4O4SnPurity:Min. 95%Color and Shape:PowderMolecular weight:754.29 g/molHS-1371 - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.
Formula:C24H24N4OPurity:Min. 95%Color and Shape:PowderMolecular weight:384.47 g/molCONSENSUS B Tat - 15
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,681.8 g/molGefitinib hydrochloride
CAS:RIPK2 protein kinase inhibitor; EGFR inhibitorFormula:C22H24ClFN4O3·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:483.36 g/molITE - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C14H10N2O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:286.31 g/molDarapladib - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C36H38F4N4O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:666.77 g/molGlial Fibrillary Acidic Protein (GFAP), Recombinant
Glial Fibrillary Acidic Protein (GFAP), Recombinant is a life science tool for use in IVD applications. Please enquire for more information about Glial Fibrillary Acidic Protein (GFAP), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.Purity:>90% By Sds-Page.Norovirus antibody
Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.
Abz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH
Abz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH is a peptide that can be used as an angiotensin I converting enzyme II substrate. It is a synthetic, non-peptide molecule that has been shown to inhibit the activity of the angiotensin I converting enzyme (ACE). This inhibition prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilation and decreased blood pressure.Formula:C35H39N7O11Purity:Min. 95%Molecular weight:733.74 g/molC.I.Direct black 32
CAS:C.I.Direct Black 32 is a diazonium salt with an average particle diameter of about 10 nm and a dichroic ratio of about 1.5. It is used in the manufacture of organic colorants, such as black, brown, blue, and green pigments. C.I.Direct Black 32 has been used as a model species to study the chemical reaction rate of small particles in solution and the kinetics of thermal decomposition of intramolecular hydrogen bonds in polyphenols at various temperatures. The material can be recycled by dissolving it in an organic solvent and precipitating it out with water or uv irradiation.br> C.I.Direct Black 32 has strong absorption properties in the ultraviolet region (UV) and is used for coloring plastics, paper products, textiles, printing ink, leathers, etc.br>Formula:C48H40N13Na3O13S3Purity:Min. 95%Molecular weight:1,172.08 g/molAPP antibody
APP antibody was raised in goat using a peptide; HMNVQNGKWDSDPSGTKTCI, as the immunogen.H-AQCY-OH
H-AQCY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AQCY-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AQCY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AQCY-OH at the technical inquiry form on this page
Purity:Min. 95%OSMR antibody
OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQPurity:Min. 95%H-AFPEDRSQPGQDCRFRVTQL-OH
H-AFPEDRSQPGQDCRFRVTQL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AFPEDRSQPGQDCRFRVTQL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AFPEDRSQPGQDCRFRVTQL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AFPEDRSQPGQDCRFRVTQL-OH at the technical inquiry form on this page
Purity:Min. 95%H-ETIEIETQVPEK^-OH
Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BMS 754807
CAS:A reversible inhibitor of IGF-1R kinase and insulin receptor. Has anti-growth effects in mesenchymal, epithelial and hematopoietic tumor types. Synergistic with other cytotoxic, hormonal and targeted anti-cancer therapy.
Formula:C23H24FN9OPurity:Min. 95%Color and Shape:PowderMolecular weight:461.49 g/molBasic blue 9
CAS:Basic blue 9 is a reactive dye that has been used in wastewater treatment and biological treatment. The adsorption of Basic blue 9 is based on the basicity of the dye, which causes it to have high resistance to degradation by light. It has also been shown to be effective for removal of organic contaminants from water, due to its strong affinity for particle surfaces. Basic blue 9 is an acrylic acid ester with a fatty acid group that can be removed by hydrolysis. The adsorption mechanism of Basic blue 9 is related to kinetic data, which can be obtained through FT-IR spectroscopy.Purity:Min. 95%H-LLLPHWAK-OH
H-LLLPHWAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLLPHWAK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLLPHWAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLLPHWAK-OH at the technical inquiry form on this page
Purity:Min. 95%Rupatadine fumarate - Bio-X ™
CAS:Rupatadine is a dual histamine H1 receptor and platelet activating factor antagonist that is used for the treatment of allergic rhinitis. It can also be used for the treatment of chronic spontaneous urticaria. This drug inhibits the H1 receptor and the platelet activating factor receptor from carrying out their roles resulting in a reduction in the symptoms of allergic rhinitis.Formula:C30H30ClN3O4Purity:Min. 95%Color and Shape:PowderMolecular weight:532.03 g/molPeptide M trifluoroacetate
Please enquire for more information about Peptide M trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C81H141N21O31•(C2HF3O2)xPurity:Min. 95 Area-%Color and Shape:PowderFibrillarin antibody
Fibrillarin antibody was raised in mouse using yeast fibrillarin as the immunogen.Purity:Min. 95%Rabbit anti Chicken IgY (H + L) (Alk Phos)
Rabbit anti-chicken IgY (H + L) (Alk Phos) was raised in rabbit using chicken IgG (H & L) as the immunogen.
Crimean-Congo Haemorrhagic Fever Virus Nucleocapsid Antigen, Recombinant
Crimean-Congo Haemorrhagic Fever Virus is a tick-borne virus that causes Crimean-Congo Haemorrhagic Fever (CCHF), a serious disease that can have a case fatality rate of up to 40% during outbreaks. The virus is an RNA virus from the Nairoviridae family and is transmitted mainly through bites from infected ticks (especially Hyalomma species) or through contact with blood or tissues from infected animals or people. It is found across Africa, the Balkans, the Middle East, and parts of Asia. Symptoms can include fever, muscle aches, dizziness, neck pain, and backache and it can progress to internal and external bleeding, liver failure, and shock. Currently there is no vaccine to combat this disease, or an antiviral treatment that has been officially approved.
The Crimean-Congo Haemorrhagic Fever Virus nucleocapsid antigen is a structural protein of the virus. It wraps around the viral RNA genome to form the nucleocapsid, protecting the RNA and helping the virus replicate inside host cells. It's highly abundant, highly conserved, and produced early during infection. This protein is therefore a prime target for use in the development of new diagnostic assays for Crimean-Congo Haemorrhagic Fever Virus detection. The fact that the nucleocapsid protein is immunogenic it can also be used in vaccine research.Cymit Quimica's recombinant Crimean-Congo Haemorrhagic Fever Virus antigen is the full-length nucleocapsid protein from strain Nigeria/IbAr10200/1970 expressed in E. coli and containing a His-tag at the C-terminus. This antigen is potentially suitable for development of serological assays, such as ChLIA, ELISA and lateral flow, to detect the presence of antibodies to CCHF virus in patient samples.LCBiot-SPDVDLGDISGINAS-OH
Peptide LCBiot-SPDVDLGDISGINAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Rabeprazole sodium salt - Bio-X ™
CAS:Rabeprazole is a proton pump inhibitor drug that is used to treat symptoms of GERD, heal gastrointestinal ulcers and eradicate Helicobacter pylori. This antiulcer drug suppresses gastric acid by inhibiting the gastric H+/K+ ATPase at the parietal cell.
Formula:C18H20N3O3SNaPurity:Min. 95%Color and Shape:PowderMolecular weight:381.43 g/molOxyphenbutazone hydrate
CAS:Inhibitor of COX-1 and COX-2 cyclooxygenasesFormula:C19H20N2O3•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:342.39 g/molC.I.Direct Blue 72
CAS:C.I. Direct Blue 72 is a versatile compound with various applications. It is used in the field of molybdenum crystallization and photocatalytic reactions. Additionally, it has cholinergic properties, which means it can interact with choline receptors in the body. This compound also contains secoisolariciresinol and sphingosine, which are both phytoestrogens known for their potential health benefits.Formula:C36H22N7Na3O10S3Purity:Min. 95%Molecular weight:877.8 g/molH-QQQQQAVPSPASAATPPASK-OH
H-QQQQQAVPSPASAATPPASK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QQQQQAVPSPASAATPPASK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QQQQQAVPSPASAATPPASK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QQQQQAVPSPASAATPPASK-OH at the technical inquiry form on this page
Purity:Min. 95%C.I.Reactive Orange 13
CAS:C.I.Reactive Orange 13 is a reactive dye that can be used for the detection of bacterial strains, including Legionella pneumophila and Pseudomonas aeruginosa. The dye reacts with metal ions to form a precipitate, which can be detected by measuring the viscosity or turbidity of the solution. C.I.Reactive Orange 13 has been shown to bind to biomass from fungi and bacteria, which is why it is often used for monitoring water quality in wastewater treatment plants and for detecting microbial contamination in food products. C.I.Reactive Orange 13 is also an effective metal chelator that can be used for kinetic studies on borohydride reduction reactions involving iron and other transition metals.
Formula:C24H15ClN7O10S3·3NaPurity:Min. 95%Molecular weight:762.04 g/molH-ATGIPDR^-OH
Peptide H-ATGIPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Orexin A human, rat, mouse
CAS:Orexin A is a neuropeptide that regulates the sleep-wake cycle and controls appetite. It has been shown to have a role in modulating the immune system, blood pressure, and energy metabolism. Orexin A is expressed in neurons and other cells in the brain, including astrocytes. It has been shown to regulate neuronal death by inhibiting pro-death signals such as caspase-3, which are released in response to stress or injury. Orexin A also interacts with toll-like receptors and receptor activity, which may be responsible for its effects on inflammatory responses.Formula:C152H243N47O44S4Purity:Min. 95%Molecular weight:3,561.1 g/molMumps virus protein
Mumps virus protein is a chemokine that plays a crucial role in various biological processes. It contains tyrosine residues that are essential for its function, including the activation of caspase-9 and inhibition of EGFR protein. This protein also stimulates endothelial growth and has been found to interact with epidermal growth factor. Native Proteins & Antigens offers monoclonal antibodies specifically designed to target this protein, making it an invaluable tool for research in the field of life sciences. These antibodies have shown neutralizing activity against mumps virus, providing valuable insights into the mechanisms of viral infection and potential therapeutic interventions.Purity:Min. 95%Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GALDLAKKSIHPDYV-OH
H-GALDLAKKSIHPDYV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GALDLAKKSIHPDYV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GALDLAKKSIHPDYV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GALDLAKKSIHPDYV-OH at the technical inquiry form on this page
Purity:Min. 95%
