Biochemicals and Reagents

<p>CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR</p>

<p>The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.</p>

<p>SRT3025 Hydrochloride is a synthetic small molecule, which is developed as an activator of the SIRT1 enzyme. SRT3025 is derived from chemical synthesis, designed specifically to modulate enzymatic activity associated with aging and metabolic regulation. The compound functions by enhancing the deacetylase activity of the SIRT1 enzyme, a member of the sirtuin family, which plays a crucial role in cellular processes related to longevity and metabolic regulation.</p>

<p>2-Isopropyl-5(methylphen-ethylamino)-2-phenylvaleronitrile hydrochloride is a peptide that acts as an inhibitor of the enzyme protein interactions. It binds to the activator and ligand sites of ion channels, and blocks the flow of ions across cell membranes. 2-Isopropyl-5(methylphen-ethylamino)-2-phenylvaleronitrile hydrochloride has been used as a research tool for the study of ion channels. It has also been used in the production of antibodies against ion channels.</p>

<p>PIK-108 is a peptide used as a research tool to study protein interactions, receptor function, and ligand binding. It interacts with ion channels and inhibits protein interactions. PIK-108 is a potent inhibitor of the human peptidyl prolyl cis/trans isomerase (PPIase) family, which includes PPIases from bacteria, plants, and humans. This inhibition prevents the enzymatic conversion of proline residues in proteins to their cis or trans forms. As a result, PIK-108 can be used to determine the importance of this enzyme for various cellular functions by testing the effect on cell growth.<br>PIC-108 has been shown to inhibit various members of the human PPIase family at low micromolar concentrations. The IC50 values for several bacterial enzymes are significantly higher than those for mammalian enzymes. The potency of PIK-108 against bacterial enzymes may be due to its high lipophilicity and increased ability to penetrate hydroph</p>

<p>AGL-2263 is a monocarboxylic acid that has been shown to have time-dependent and site-specific effects on glycogen metabolism. This drug inhibits the activity of glycogen synthase and glycogen synthase kinase, which are enzymes that catalyze the formation of glycogen from glucose. AGL-2263 also inhibits 3T3-L1 cells proliferation in culture, which may be due to its ability to induce receptor β downregulation. The mechanism of this drug's effect on cellular proliferation is not yet known.</p>

<p>AZ-33 is a synthetically optimized biochemical compound, which is derived from naturally occurring plant alkaloids. With a robust mode of action, AZ-33 functions by selectively inhibiting specific enzymatic reactions, allowing precise modulation of metabolic pathways. This selectivity is achieved through its affinity for enzyme binding sites, where it interferes with substrate interactions.<br><br>The compound is used primarily in the field of biochemical research, where it serves as a critical tool in the exploration of metabolic processes and enzymatic functions. By providing insights into enzyme-related pathways, AZ-33 supports the development of potential therapeutic strategies and enhances the understanding of complex biochemical phenomena. Its applications extend to various domains, including pharmacology, molecular biology, and systems biology, making it an invaluable asset for exploratory research and experimental investigations in these fields.</p>

<p>Dopamine (D2) receptor antagonist; antisychotic</p>

<p>BMS-833923 is a small molecule that inhibits the activity of epidermal growth factor receptor (EGFR) tyrosine kinase in hypoxic tumor cells, which are found in approximately one-third of all solid tumors. BMS-833923 has been shown to inhibit EGFR tyrosine kinase activity by binding to the ATP site of EGFR and blocking the formation of ATP-EGFR complexes. The inhibition leads to a decrease in downstream signaling, including decreased activation of the mitogen-activated protein kinases and p38 MAPK pathways. BMS-833923 has also been shown to be active against metastatic pancreatic cancer cells. Pharmacokinetic studies have shown that BMS-833923 is metabolized via CYP3A4/5; however, this does not affect its antitumor activity or toxicity.</p>

<p>Melatonin receptor antagonist</p>

<p>Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA</p>

<p>(S)-5-((1,1'-Biphenyl)-4-ylmethyl)pyrrolidin-2-one is a ligand of the beta2 adrenergic receptor. It is an inhibitor of ion channels and has been shown to be an excellent research tool for studying cell biology and receptor binding. (S)-5-((1,1'-Biphenyl)-4-ylmethyl)pyrrolidin-2-one can be used in the study of peptides or antibodies that interact with the beta2 adrenergic receptor.</p>

<p>Rat monoclonal V alpha 2 TCR antibody (PE)</p>

<p>Purified recombinant DEFB116 protein (His tag)</p>

<p>Phthalide 13C6 is an analog of a naturally occurring compound found in Chinese medicinal plants. It has been shown to have potent anticancer properties, inducing apoptosis in cancer cells and inhibiting tumor growth. Phthalide 13C6 acts as a kinase inhibitor, disrupting the cell cycle and preventing the production of proteins necessary for cancer cell survival. This compound has also been studied for its potential use as a biomarker for cancer diagnosis, as it can be detected in urine samples from patients with certain types of cancer. With its promising potential as an anticancer agent, Phthalide 13C6 is a valuable addition to the field of medicinal research.</p>

<p>Purified recombinant BMP6 protein (His tag)</p>

<p>Activator of NAMPT transferase</p>

<p>Reutericyclin is a novel antibiotic that inhibits fatty acid synthesis. It has been shown to be effective against oral pathogens and microbial infections. Reutericyclin has been shown to inhibit the growth of bacteria by binding to the bacterial fatty acid synthase, which is an enzyme that catalyzes the first step in the biosynthesis of fatty acids. The drug also binds to ATP synthase, preventing the production of ATP, which is needed for bacterial cell division. Reutericyclin has been shown to have antimicrobial properties in both model systems and humans, but it does not have any significant side effects on humans or animals.</p>

<p>Apilimod mesylate is a small molecule that inhibits viral replication by selective inhibition of the toll-like receptor (TLR) signaling pathway. Apilimod mesylate has been shown to have significant cytotoxicity in vitro and in vivo. It also has the ability to inhibit both TLR-3 and TLR-4, which are receptors for the recognition of lipopolysaccharide, an inflammatory molecule produced by Gram-negative bacteria. Apilimod mesylate has been shown to be effective in treating bowel disease and eye disorders such as dry eye. Apilimod mesylate has a long half-life and provides significant efficacy following long term treatment with no observed toxicity.</p>

<p>Rabbit polyclonal RNF138 antibody</p>

<p>Rat monoclonal CCR7 antibody (biotin)</p>

<p>M8-B hydrochloride is a monoclonal antibody that binds to the extracellular domain of the cation channel (TRPA1) and inhibits its activity. It has been shown to inhibit spontaneous pain in mice with neuropathic pain and inflammatory pain. M8-B hydrochloride also blocks TRPA1 activity in prostate cancer cells, which are used as an experimental model for prostate cancer.</p>

<p>LEO1 antibody was raised in Rabbit using Human LEO1 as the immunogen</p>

<p>Purified Rabbit polyclonal BMP8B antibody</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>(R)-N-(3-Methoxy-alpha-phenylethyl)-3-(2'-chlorophenyl)-1-(propylamine hydrochloride) is a potent, selective, and competitive inhibitor of mammalian voltage-gated sodium channels. This compound has been shown to inhibit the activity of the alpha subunit of the voltage-gated sodium channel in rat brain and dorsal root ganglia neurons. (R)-N-(3-Methoxy-alpha-phenylethyl)-3-(2'-chlorophenyl)-1-(propylamine hydrochloride) is a potent ligand for the Cloned Human NGF Receptor and binds to this receptor with high affinity. It is used as a research tool for studying protein interactions and peptides, as well as an antibody for cell biology studies.</p>

<p>Batabulin is a peptide that is used as a research tool for ion channels and receptor interactions. It has been shown to inhibit the activation of potassium channels by binding to the Kv1.3 channel protein, which results in the inhibition of sodium currents. Batabulin has also been shown to inhibit the interaction between receptors and ligands, such as acetylcholine, histamine, and serotonin. Batabulin is an inhibitor of protein interactions and can be used in pharmacology studies.</p>

<p>The BRAF antibody is a highly specialized and reactive antibody that targets the activated form of the BRAF protein. This protein is involved in cell growth and plays a crucial role in various biological processes. The BRAF antibody is cytotoxic, meaning it has the ability to kill cells that express high levels of the activated BRAF protein.</p>

<p>U91356 is an agonist of the nicotinic acetylcholine receptor. It is a potent inhibitor of ACh-activated currents in rat sympathetic neurons, and also inhibits potassium-evoked currents in rat hippocampal neurons. U91356 is a competitive antagonist at the alpha3beta4 nicotinic acetylcholine receptor, but does not inhibit responses to ACh or nicotine in mice with alpha7 nicotinic acetylcholine receptor deficiency.</p>

<p>PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR</p>

<p>BLZ 945 is a novel small molecule that inhibits the activation of microglia, which are immune cells in the brain. It has been shown to inhibit tumor growth and radiation-induced tissue damage in cancer research. BLZ 945 also reduces the severity of autoimmune diseases by inhibiting the production of pro-inflammatory cytokines such as csf-1r and toll-like receptor 4. In addition, it has anti-inflammatory properties due to its inhibition of macrophage migration and adhesion. The drug has been shown to reduce the size of solid tumours in mice by reducing tumor angiogenesis and inhibiting cell proliferation.</p>

<p>Purified recombinant Human OLA1 protein (His tag)</p>

<p>TTC-352 is a small molecule that selectively modulates the activity of certain ion channels. It is an inhibitor of the Kv1.3 channel, which is expressed in neurons and dorsal root ganglion cells. TTC-352 has been shown to inhibit neuronal activity and to be an effective analgesic when used in combination with morphine. TTC-352 has also been shown to have anticancer properties as an inhibitor of epidermal growth factor receptor (EGFR) signaling and as a potential treatment for metastatic melanoma. The ligand binds to the receptor, preventing it from binding to its natural ligands, inhibiting downstream signaling pathways. This inhibition leads to cell death by apoptosis or necrosis depending on the type of cancer cell.</p>

<p>Purified recombinant TMED10 protein (His tag)</p>

<p>The BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is designed to bind to the glycan moiety of TNF-α, preventing its interaction with cell surface receptors. This antibody can be used in various research applications, such as immunohistochemistry and flow cytometry, to detect and quantify TNF-α levels. The BSG antibody has been extensively validated and shown to have high specificity and affinity for TNF-α. Its neutralizing properties make it a valuable tool for studying the role of TNF-α in various physiological and pathological processes. Additionally, this antibody has been used in therapeutic settings, such as the treatment of inflammatory diseases like rheumatoid arthritis, where excessive TNF-α production plays a key role in disease progression.</p>

<p>ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE</p>

<p>The MPL antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the myeloproliferative leukemia (MPL) receptor, which is a tyrosine kinase receptor involved in the regulation of hematopoiesis. This antibody has been extensively studied and has shown neutralizing activity against MPL ligands such as thrombopoietin, resulting in the inhibition of downstream signaling pathways.</p>

<p>Inhibitor of Aurora kinase</p>

<p>ZNF644 antibody was raised in rabbit using the middle region of ZNF644 as the immunogen</p>

<p>OD 36 is an anti-VEGF compound that is used as a diagnostic tool to detect the presence of VEGF in the eye. It is also used for intravitreal injection to treat retinal disorders such as age-related macular degeneration and diabetic retinopathy. OD 36 has been shown to be resistant to surfactants, making it suitable for use in aqueous solutions. This chemical does not have any intrinsic anti-oxidant properties, but can be stabilized by the addition of other anti-oxidants. OD 36 is insoluble in water and should be stored at low temperatures to prevent precipitation. OD 36 has shown no immunogenicity or toxicity in animals, although it may cause pigmentosa when injected into the eye.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>The DPPA2 antibody is a monoclonal antibody that targets and neutralizes the growth factor DPPA2. It has been shown to inhibit caspase-9 activity, which plays a crucial role in apoptosis. This antibody is formulated with excipients such as histidine and colloidal globulin to enhance stability and efficacy. It can be used in various applications in Life Sciences, including research on mesenchymal stem cells and alpha-fetoprotein. The DPPA2 antibody is a highly specific and potent tool for studying the function of DPPA2 and its role in cellular processes.</p>

<p>MAP3K11 antibody was raised using the middle region of MAP3K11 corresponding to a region with amino acids PVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPR</p>

<p>KLC1 antibody was raised in Rabbit using Human KLC1 as the immunogen</p>

<p>Purified recombinant STRADA protein (His tag)</p>

<p>PJ34 is a chemical compound that induces apoptosis in cancer cells. It has been shown to induce caspase-independent cell death in myeloma cells and HL-60 leukemia cells, but not in normal cells. PJ34 is a selective inhibitor of PARP-1, an enzyme that regulates the balance between DNA repair and apoptosis. This drug also induces neuronal death by inhibiting basic proteins without inducing necrosis.</p>

<p>The Histone H3 antibody is a monoclonal antibody that specifically targets histone H3, a protein involved in the packaging of DNA into chromatin. This antibody is commonly used in research studies to investigate histone modifications and their impact on gene expression. It is particularly useful for techniques such as chromatin immunoprecipitation assay (ChIP) which allows researchers to study the interactions between proteins and DNA. The Histone H3 antibody has been extensively validated and is known for its high specificity and sensitivity. It has been successfully used in various applications including Western blotting, immunofluorescence, and immunohistochemistry. Researchers can rely on this antibody to accurately detect histone H3 acetylation levels and gain insights into epigenetic regulation of gene expression.</p>

<p>ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC</p>

<p>Asp 2535 is a sodium hypochlorite-based compound, which is a chlorine-releasing agent with potent antimicrobial properties. It originates from the oxidation of sodium chloride and displays its efficacy through the release of hypochlorous acid upon dissolution in water. This mode of action involves the disruption of essential cellular processes in microorganisms, including protein synthesis and nucleic acid structure, ultimately leading to cell death.</p>

<p>Rabbit polyclonal SERINC3 antibody</p>

<p>SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>YHO-13177 is a novel chemotherapeutic drug that is being investigated for its effectiveness against cancer. YHO-13177 has been shown to inhibit the ATP binding cassette transporter, which prevents the export of nucleotides from cells and inhibits DNA synthesis. It also inhibits cancer cell proliferation in a dose-dependent manner and has been shown to be effective against murine leukemia. YHO-13177 has been shown to bind to human cervical carcinoma cells, but not to healthy cells, suggesting that it may have potential as a treatment for cervical cancer.</p>

<p>Rabbit polyclonal CaMK1A antibody (Thr177)</p>

<p>Please enquire for more information about Dihydro nicotyrine-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Rabbit polyclonal OR5B12 antibody</p>

<p>TMEM126B antibody was raised using the N terminal of TMEM126B corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT</p>

<p>KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV</p>

<p>AZD 8186 is a selective small-molecule inhibitor, which is sourced from synthesized chemical compounds, specifically designed to target the phosphoinositide 3-kinase (PI3K) pathway. This inhibitor functions by selectively inhibiting the PI3K isoforms, primarily PI3Kβ and PI3Kδ, which play critical roles in multiple cell signaling pathways related to growth, survival, and proliferation.</p>

<p>N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine is a peptide and an inhibitor of ion channels. It was originally isolated from the venom of the Brazilian spider Phoneutria nigriventer. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine binds to voltage gated sodium channels, inhibiting the opening of these channels. This inhibition prevents the propagation of action potentials, and leads to a cessation in neural activity. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine also inhibits potassium channels by binding to the S4 region of these channels. The inhibition of potassium channels leads to hyperpolarization and a decrease in neural activity.</p>

<p>The ATF2 antibody is a highly specialized antibody that is used in Life Sciences research. It is an inhibitor of the epidermal growth factor and acts as a cytotoxic agent against specific cells. This monoclonal antibody specifically targets ATF2, a transcription factor involved in cell growth and development. The ATF2 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both a recombinant antigen and as polyclonal antibodies. The neutralizing properties of this antibody make it an essential tool for studying the role of ATF2 in cellular processes. With its high specificity and affinity to the target protein, the ATF2 antibody provides accurate and reliable results in research experiments.</p>

<p>4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4-ol is a potent and selective activator of the human TRPA1 receptor. It has been shown to activate the channel and induce calcium influx in human embryonic kidney cells. This compound can also be used as a research tool to study protein interactions and pharmacology. The purity of this product is high, with no detectable impurities. 4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4 -ol is available for purchase from Sigma Aldrich at CAS No. 8734456044.</p>

<p>Purified Rabbit polyclonal ETNK1 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The RAGE antagonist peptide is a peptide that binds to RAGE and inhibits its pro-angiogenic effects. This peptide has been shown to inhibit the growth of prostate cancer cells in vitro and in vivo, as well as induce the apoptosis of these cells. The RAGE antagonist peptide also blocks the activation of nuclear DNA, which prevents transcriptional regulation and protein synthesis. In addition, this peptide can bind to calcium ions and inhibit the activity of toll-like receptor 4 (TLR4). The RAGE antagonist peptide has also been shown to have anti-angiogenic effects on a variety of cancers, including prostate cancer tissues.</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>Rabbit polyclonal RAB11FIP2 antibody</p>

<p>Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF</p>

<p>The anti-human CCR1 is a potent cytotoxic agent that targets the CCR1 receptor, a key molecule involved in various cellular processes. This monoclonal antibody specifically binds to the CCR1 receptor and inhibits its activation, leading to reduced collagen production and endothelial cell growth. The anti-human CCR1 antibody has been extensively studied in Life Sciences research and has shown significant efficacy in suppressing cell cytotoxicity. It is also effective against multidrug-resistant cells that overexpress the CCR1 receptor. Furthermore, this antibody can be used in combination with other therapeutic agents such as ethionamide to enhance their efficacy. The anti-human CCR1 antibody exhibits high specificity and affinity towards its target molecule, making it a valuable tool for researchers studying immune responses and inflammatory diseases. Additionally, this antibody has been used in hybridization studies to detect the presence of CCR1 mRNA and protein expression levels. Its ability to inhibit superoxide production further highlights its potential as an important tool in understanding</p>

<p>Rabbit polyclonal SCO1 antibody</p>

<p>Mouse anti- Furacilinum metabolite monoclonal antibody</p>

<p>Mogroside I E1 is a sweetener that is structurally related to mogrosides. It has been shown to inhibit the dna polymerase activity and reduce cancer cell proliferation. This product was developed as a health-care product for the treatment of diabetes, obesity, and hypertension. Mogroside I E1 is also used as a flavoring agent in food products. Mogroside I E1 is synthesized from mogrosides by dehydration of the sugar moiety with alcohols and oxidation of the sugar moiety with hydrogen peroxide or sodium persulfate.</p>

<p>Ilorasertib hydrochloride is a selective multi-targeted kinase inhibitor, which is derived from meticulous synthetic chemistry processes aimed at producing potent therapeutic agents. With a primary mechanism of action that involves the inhibition of several key kinases, Ilorasertib hydrochloride acts to disrupt critical signaling pathways essential for cancer cell proliferation and survival. This mechanistic approach involves the targeting of enzymes such as cyclin-dependent kinases (CDKs) and VEGFR, which are pivotal in various cancerous processes.</p>

<p>CACYBP antibody was raised in Rabbit using Human CACYBP as the immunogen</p>

<p>SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL</p>

<p>Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET</p>

<p>Please enquire for more information about FGTI-2734 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sulfo-SPDB is a lysine analog that has potent antitumor activity and is being evaluated as a potential cancer therapeutic agent. It inhibits tumor growth in vitro by inhibiting the expression of proteins important for cell division and survival. Sulfo-SPDB binds to the lysine residues on the surface of cells, including erythrocytes, lymphocytes, and tumor cells. This binding prevents protein synthesis and cell division. In vivo studies have shown that sulfo-SPDB is effective against human liver cancer xenografts in mice, cervical cancer xenografts in mice, and t-cell lymphoma xenografts in mice. Clinical studies are underway to determine if it is safe for use in humans.</p>

<p>The CD123 antibody is a trifunctional genotoxic antibody that targets the tyrosine kinase receptor CD123. It belongs to the class of monoclonal antibodies and has been shown to have anti-beta amyloid properties. This antibody works by binding to CD123, which is expressed on the surface of certain cells, including cancer cells. Once bound, it activates protein kinase pathways and chemokine signaling, leading to cell death and inhibition of tumor growth. The CD123 antibody has also been found to modulate phosphatase activity and regulate the expression of growth factors such as alpha-fetoprotein. This antibody is widely used in the field of life sciences for research purposes and has shown promising results in preclinical studies.</p>

<p>IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 2 as the immunogen.</p>

<p>Lamin B2 antibody was raised using the middle region of LMNB2 corresponding to a region with amino acids EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM</p>

<p>NSC 23925 is a quinoline derivative that inhibits the activity of drug transporters, which are proteins that pump drugs out of the cell. It selectively targets cancer cells and has been shown to inhibit the growth of human osteosarcoma cells. NSC 23925 has been tested in patients with lung cancer and found to be safe, with no significant side effects. This drug is also used in combination with other drugs to treat skin cancer, Kaposi's sarcoma, and myeloma.</p>

<p>Synthetic human phosphopeptide (Ser645) region immunogen; rabbit polyclonal Rad17 antibody (Ser645)</p>

<p>TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT</p>

<p>SS-208 is an advanced chemical compound used for de-icing applications, which is synthesized from a proprietary blend of glycol-based components. Its mode of action involves disrupting the hydrogen bonds in ice, effectively lowering the freezing point and facilitating the melting process. By altering the crystalline structure of the ice, SS-208 provides a rapid and efficient means of ice removal.</p>

<p>MDR-652 is a novel analgesic that has potential to act as a vanilloid receptor agonist. It is a synthetic, non-opioid, non-NSAID medicine with analgesic activity and the potential to treat neuropathic pain. MDR-652 has been shown to be effective in animal models of neuropathic pain, such as allodynia and mechanical hyperalgesia. MDR-652 also has the ability to cross the skin barrier and reach the systemic circulation. MDR-652 is not active against gram positive bacteria (e.g., Staphylococcus aureus) or anaerobic bacteria (e.g., Clostridium difficile).<br>MDR-652 also acts on TrpV1 receptors and has been shown in animal models to reduce inflammatory responses in tissues by inhibiting substance P release from sensory nerve endings.</p>

<p>The chemical compound Z-Gly-Gly-Arg-amc acetate is a proteolytic inhibitor. It inhibits the serine protease activity by binding to the active site of the enzyme and blocking its reaction with the substrate. This prevents the hydrolysis of proteins and thrombin formation, which is important for blood clotting. It has been shown to have a positive effect on the treatment of cancer and bone diseases in clinical studies. The skeleton contains about 20% of protein, most of which are collagen and elastin. These proteins are degraded by proteolytic enzymes, such as plasminogen activator, kallikrein, trypsin, and thrombin. The skeleton undergoes continuous remodeling through bone resorption and deposition that is regulated by these enzymes.</p>

<p>MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII</p>

<p>MLS6585 is a functional allosteric modulator of the dopamine D2 receptor. It has been shown to increase the affinity and inhibitory effect of dopamine at the D2 receptor. MLS6585 was found to have a significant effect on neuronal function in rats, reversing dyskinesia and improving motor function. This drug also reduced blood pressure and had an anti-inflammatory effect in mice. MLS6585 is currently being developed as a treatment for Parkinson's disease, depression, and hypertension.</p>

<p>ML337 is a functional ligand that binds to the metabotropic glutamate receptor subtype 2 (mGlu2). It has been shown to be an allosteric modulator of mGlu2, where it acts as an agonist at low concentrations and as a negative allosteric modulator at high concentrations. ML337 has been shown to inhibit calcium-sensing receptor function in renal cells and may have potential for the treatment of chronic kidney diseases.</p>

<p>SR 13800 is a nutritional supplement that contains branched-chain amino acids. It is used to help transport the active substances into muscle cells. This supplement has been shown to increase the uptake of amino acids by mammalian cells in culture and has an oral bioavailability of 100%. SR 13800 is not currently available in any other form besides a powder. It can be dissolved in water and consumed as a drink, or mixed with food. The product does not contain any other ingredients besides amino acids and does not require refrigeration.</p>

<p>K 114 is a selective herbicide, which is a synthetic chemical intervention designed to target and manage unwanted plant species in agricultural settings. Derived from advanced chemical synthesis processes, it ensures high purity and efficacy in real-world applications. The mode of action involves the inhibition of key enzymatic pathways crucial for the survival and growth of broadleaf and grassy weeds, thereby effectively hindering their development without affecting the desired crops.</p>

<p>YM-254890 is a potent inhibitor of protein α and alkoxy radical in the thrombin receptor. It has been shown to be effective in inhibiting blood pressure and α subunit, which is one of the main proteins involved in the regulation of blood pressure. YM-254890 is a hydrogenated analog that belongs to the class of non-selective cations. It also inhibits protein synthesis, which may be due to its binding to the carbonyl group and protein inhibitors. The biological properties of YM-254890 have been studied with carboxylic acid groups, including thrombin receptors, and it has been found that this drug can inhibit cancer cell growth.</p>

<p>Mouse monoclonal CKMB antibody (MM subunit)</p>

<p>Mouse monoclonal NIT2 antibody</p>

<p>Cathepsin inhibitor</p>

<p>Mouse monoclonal 200 kDa Neurofilament antibody</p>

<p>VU591 is a molecular probe, which is a synthetic chemical compound designed for research purposes. It originates from a series of high-throughput screening processes aimed at identifying modulators of X-linked inhibitor of apoptosis proteins (XIAP). The mode of action of VU591 involves binding to the XIAP, thereby disrupting its interaction with caspases, essential components in cellular apoptosis pathways. By modulating XIAP, VU591 can serve as an effective tool in studying apoptosis regulation and its implications in diseases where cell death is dysregulated, such as cancer. It is commonly utilized in laboratory settings to elucidate the molecular mechanisms governing apoptosis and to investigate potential therapeutic strategies targeting XIAP-mediated pathways, offering valuable insights for developing anti-cancer treatments.</p>

<p>Rabbit polyclonal UBE2D4 antibody</p>

<p>ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE</p>

<p>Mouse monoclonal MTMR14 antibody</p>

<p>PSN-GK1 is a research tool that can be used to activate or inhibit ion channels. PSN-GK1 binds to the receptor and activates the cell by initiating a signal transduction pathway. It is an inhibitor for potassium channels and may be used in pharmacology to treat diseases such as epilepsy, Parkinson's disease, and chronic pain.</p>

<p>Rabbit polyclonal KCNMB2 antibody</p>

<p>The Erythropoetin antibody is a molecule drug that acts as an inhibitor of activated protein kinase. It is a monoclonal antibody that specifically targets and neutralizes erythropoietin, a hormone responsible for red blood cell production. This antibody can be used in various applications in the field of Life Sciences, including research on diseases such as cancer (e.g., MCF-7 cells) and the development of therapeutics. The Erythropoetin antibody is often conjugated to microspheres or other carriers for easy detection and isolation. Additionally, it has been shown to have anticoagulant properties by inhibiting the interaction between fibrinogen and platelets.</p>

<p>The ACY1 antibody is a monoclonal antibody that targets the ACY1 protein. ACY1 is an enzyme involved in various biological processes, including dopamine metabolism and apoptosis regulation. This antibody specifically binds to ACY1 and can be used for research purposes in the field of life sciences.</p>

<p>CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL</p>

<p>Mouse monoclonal PGAM2 antibody</p>

<p>3-AQC is a mitochondrial respiratory chain inhibitor that inhibits electron transport and the production of ATP. 3-AQC is taken up by mitochondria and functions in the respiratory chain. The drug has significant effects on cellular organelles, such as the cell membrane, and can be used to study mitochondrial functions. The drug was found to have significant effects on cardiomyocytes, leading to cardiac dysfunction in neonatal rats.</p>

<p>Saquinavir Mesylate (USP grade powder) chemical reference substance</p>

<p>The AGPAT4 antibody is a monoclonal antibody designed for hybridization in the field of Life Sciences. It specifically targets and activates the AGPAT4 protein, which plays a crucial role in various biological processes. This antibody has been shown to interact with oncostatin, osteopontin, basic protein, e-cadherin, serum albumin protein, and β-catenin. By binding to these proteins, the AGPAT4 antibody can modulate their expression and function. Additionally, this antibody has demonstrated high specificity and affinity for human serum samples. It can be used in various research applications such as Western blotting, immunohistochemistry, and ELISA assays. The AGPAT4 antibody is an invaluable tool for scientists studying cellular signaling pathways and investigating potential therapeutic targets.</p>

<p>Rabbit polyclonal SMA4 antibody</p>

<p>FT827 is a small molecule that is a covalent inhibitor of ubiquitin ligases. FT827 inhibits the activity of the proteasome by inhibiting ubiquitin ligases and proteasome-dependent protein degradation. FT827 has been shown to inhibit cancer growth in organoids, as well as infection by Borrelia burgdorferi, an agent of Lyme disease. FT827 was also shown to inhibit the replication of rabies virus in vitro. The precise molecular mechanism of action for this drug remains unknown, but it may be due to its ability to inhibit ubiquitin ligases.<br>!--END--&gt;</p>

<p>Rabbit polyclonal TRIM17 antibody</p>

<p>The CK18 antibody is a highly specialized monoclonal antibody that targets collagen in the body. Collagen is an essential protein that provides structure and support to various tissues and organs. This antibody specifically binds to collagen, allowing for targeted therapy and research applications.</p>

<p>MMP19 antibody was raised in Rabbit using Human MMP19 as the immunogen</p>

<p>Rabbit polyclonal Synuclein pan antibody</p>

<p>PFI-4 is a small molecule that has been shown to inhibit cancer cell growth and proliferation. It is a hydroxyl group analog that binds to the bromodomain of proteins in the cellular nucleus and blocks the interaction between acetylated histones and transcription factors. PFI-4 also inhibits virus replication, specifically influenza virus, by binding to the stem cell-like antigen. This drug is an optical imaging agent that can be used for optical imaging of cells with stem cell-like phenotypes. PFI-4 also inhibits tumor growth by disrupting the disulfide bond in water molecules.</p>

<p>MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD</p>

<p>Please enquire for more information about GSK 591 dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CD11c antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ARRB1 antibody is an antiviral agent that is commonly used in Life Sciences research. It specifically targets the ARRB1 protein, which plays a crucial role in various cellular processes. This monoclonal antibody can be used in assays to detect and quantify ARRB1 levels in samples. Additionally, it has neutralizing properties, meaning it can block the activity of ARRB1 and prevent its function. The ARRB1 antibody is produced using advanced techniques and high-quality excipients to ensure its stability and effectiveness. It has been extensively tested for specificity and potency, making it a reliable tool for researchers studying the function of ARRB1 in different biological systems.</p>

<p>Purified Polyclonal SERINC2 antibody</p>

<p>The TGM1 antibody is a polyclonal antibody that targets the transglutaminase 1 (TGM1) protein. This antibody is widely used in life sciences research to study the role of TGM1 in various cellular processes. TGM1 is an important enzyme involved in the crosslinking of proteins and plays a crucial role in the formation of the skin barrier. It is primarily expressed in epithelial cells and is essential for normal skin development and function.</p>

<p>MAN1A2 antibody was raised in Rabbit using Human MAN1A2 as the immunogen</p>

<p>Purified recombinant SH3BGRL2 protein (His tag)</p>

<p>Goat polyclonal Human Complement C4 antibody</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Purified recombinant POP7 protein (His tag)</p>

<p>Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG</p>

<p>Snf8 antibody was raised in rabbit using the N terminal of Snf8 as the immunogen</p>

<p>Rabbit polyclonal TADA3 antibody (biotin)</p>

<p>BMS-1001 hydrochloride is a peptide that is an activator of ion channels. It has been shown to inhibit the activation of potassium channels and calcium channels in rat brain slices. BMS-1001 hydrochloride also binds to the receptor site of human calcitonin gene-related peptide (CGRP) and blocks its binding to CGRP receptor sites on mast cells. This prevents the release of histamine, which is responsible for allergic reactions such as hay fever, asthma, and chronic urticaria.<br>BMS-1001 hydrochloride has been shown to be a potent inhibitor of protein interactions with ligands and receptors. It inhibits the interaction between human erythropoietin (EPO) and its receptor by competing with endogenous EPO for binding sites on the surface of erythrocytes.</p>

<p>(E)-5-(4-Chlorophenyl)-3-phenylpent-2-enoic acid is an anti-inflammatory compound, which is synthesized through organic chemical processes. Its mode of action involves the inhibition of cyclooxygenase enzymes, thereby reducing the synthesis of pro-inflammatory mediators such as prostaglandins. This action is critical in diminishing inflammation and associated symptoms.</p>