Carboxylic Acids

<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>

<p>Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Des(2-diethylamino) metoclopramide acetic acid is a benzyl ester of metoclopramide, a prodrug that is metabolized to the active form in the body. It has been shown to be effective against healthy human subjects and hplc analyses of biological samples have shown it to be a metabolite of metoclopramide. N-Des(2-diethylamino) metoclopramide acetic acid is used as a catalyst for catalytic hydrogenation reactions, such as the conversion of methyl esters into ethyl or butyl esters. It can also be used for catalytic hydrogenation reactions with diazomethane, such as those required for the synthesis of quinolones.</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Amino-5-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.​</p>

<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>

<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>Z-L-alpha-aminobutyric acid is a homogeneous, optically active, linear phosphinic analogue of alpha-aminobutyric acid. It has been used in the synthesis of phosphinic analogues of cyclosporin and undecapeptides with high yields. The coupling reaction between Z-L-alpha-aminobutyric acid and benzaldehyde was carried out in two steps to produce the desired product. A stepwise condensation between Z-L-alpha-aminobutyric acid and 3,4,5,6 tetrahydropyrimidine was also successful.</p>

<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>

<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol.<br>Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.</p>

<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>

<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>

<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>

<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>

<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>

<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nociceptin (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>

<p>Please enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vitamin A acetate is a retinoid that can be used to supplement dietary intake of vitamin A. It is a synthetic retinoid and is chemically similar to retinol, the natural form of vitamin A. Vitamin A acetate has been shown to have antioxidant properties in vitro and in vivo, which are likely due to its ability to regenerate endogenous antioxidants. This agent also has pro-apoptotic effects on cells that are exposed to oxidative injury or exhibit redox potentials below -400 mV. In addition, it significantly reduces oxidative injury caused by pharmacological agents such as doxorubicin or bleomycin.</p>

<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Mercaptobenzoic acid is a low potency, but pharmacologically active, compound that has been shown to have antioxidative properties in the mouse tumor model. It has also been shown to cause cancer cell death by reducing the stability of disulfide bonds on proteins and inhibiting the growth of carcinoma cells. 2-Mercaptobenzoic acid is used to treat metabolic disorders, such as diabetes mellitus and hyperlipidemia, and may also be used to treat cancer. 2-Mercaptobenzoic acid is found in human urine at levels of 1.5-3.3μg/mL.<br>2-Mercaptobenzoic acid was first synthesized in 1891 by the German chemist Heinrich Caro (1850-1924).</p>

<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>

<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>

<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>