Carboxylic Acids

<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>

<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amide; Trifluoroacetate salt</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>

<p>Trifluoroacetate salt</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.</p>

<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>

<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(4-Chlorophenyl-acetyl)benzoic acid is a fine chemical that is a versatile building block and useful intermediate. 2-(4-Chlorophenyl-acetyl)benzoic acid is used in the manufacture of other chemicals, such as pharmaceuticals, pesticides, dyes, or perfumes. It is also used for research purposes and as a reagent. It has a CAS number of 53242-76-5.</p>

<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>

<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>

<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>Please enquire for more information about Tert-butyl 4-(3-hydroxypropyl)tetrahydro-1(2H)-pyridinecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxy-6-picolinic acid (2MPA) is a picolinate that has been shown to be an effective catalyst for the conversion of alcohols into allylic alcohols. 2MPA is able to catalyze the reaction by abstracting hydrogen from the carbonyl group, and then adding it to the adjacent carbon. This reaction can produce peroxide as a byproduct, which is subsequently hydrolyzed to form water and alcohol. The β-unsaturated carbonyl group of 2MPA provides additional stability for this catalytic process.<br>2MPA can also be used as a catalyst in other reactions, such as the oxidation of benzylic alcohols with hydrogen peroxide to form benzylic carbonyl compounds.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>

<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>

<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>

<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>