Carboxylic Acids

<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>

<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>

<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pancreastatin is a cytosolic protein that inhibits the production of peptide hormones such as glucagon, insulin, and gastrin. It is used to treat bowel disease, including carcinoid syndrome and inflammatory bowel disease. Pancreastatin has been shown to inhibit the activity of cyclase enzymes that are responsible for the production of these hormones. Pancreatic beta-cells produce pancreatic polypeptide (PP), which is converted by pancreastatin into inactive PP2. Pancreatic alpha-cells produce somatostatin (SS), which is converted by pancreastatin into inactive SS2. Pancreatic delta cells produce pancreatic polypeptide (PP), which is not affected by pancreastatin. Pancreatic somatostatinomas secrete SS, which is not affected by pancreastatin.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>

<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,2'-Biphenyldicarboxylic acid anhydride is a diphenic anhydride that has a carboxylate group on one end and a phenyl group on the other. The nitrogen atoms in this molecule are part of the intramolecular hydrogen bonds that stabilize the molecule. 2,2'-Biphenyldicarboxylic acid anhydride is used in wastewater treatment as it reacts with amines to form ammonium salts. This process also releases hydrogen, which can be used for fuel cells or light emission. It is also used to produce other compounds such as malonic acid and phenylacetic acid.</p>

<p>Please enquire for more information about 3-Fluorophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>

<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>

<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>

<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>

<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Please enquire for more information about (Asp56)-pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is a compound that has been used as an analytical reagent and as a precursor to other chemicals. It is a white solid with a melting point of about 40°C. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is soluble in hexane, benzene, and diethylether. It also reacts with fatty acids to produce polymers. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester has been shown to be an effective antibacterial agent against Gram negative bacteria such as Escherichia coli and Pseudomonas aeruginosa.</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxy-4-(methylthio)butanoic acid (2HMB) is an amide that is used as a microbial metabolism inhibitor, especially for the inhibition of bacterial growth. 2HMB and its analogues are also used in plant physiology. 2HMB has been shown to have transport properties and can be used as an inorganic acid for the manufacture of hydrochloric acid. It has been found to have enzyme activities, such as polymerase chain reaction and hydroxyl group transferases, which make it a useful catalyst for reactions involving organic compounds. The hydroxyl group in 2HMB makes it a good candidate for use in fatty acid synthesis and oxidation reactions. Chronic exposure to this chemical may lead to carbonyl oxygen formation.</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>

<p>1-Acetylpiperidine-4-carboxylic acid (ACPC) is a synthetic compound that has been shown to be a potent inhibitor of the neurokinin-1 receptor. ACPC has been shown to have anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. It has also been shown to have antipsychotic effects and could be an effective treatment for psychotic disorders. The pharmacophore of ACPC is based on the cyclohexane ring and piperidine moieties, which are thought to provide affinity for the neurokinin-1 receptor.</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>

<p>Aminocaproic acid is a non-specific lysing agent that is used in the treatment of acute blood clots. Aminocaproic acid has minimal toxicity and low-dose effects, and can be used for the treatment of thrombotic disorders. It also has biological properties that are different from those of aminocaproate, which can lead to a more rapid dissolution of the clot. Aminocaproic acid is an organic compound that belongs to the class of dicarboxylic acids. It is synthesized from two molecules of aminoacetic acid by the enzyme aminocaproic acid synthetase. The synthesis occurs in a two-step process: first, caprylic acid reacts with ATP to form aminopropyl-adenylate (APA), followed by hydrolysis by APA lyase to form aminocaproic acid.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>

<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>

<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>

<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>

<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END&gt;</p>

<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>

<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>