Carboxylic Acids

<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>

<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>

<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>

<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of afatinib</p>

<p>Suc-Ala-Phe-Lys-AMC acetate salt is a fatty acid that is metabolized by the enzyme plasminogen activator inhibitor 1 (PAI-1) to form AMC. It is used as a marker for PAI-1 activity in plasma, as well as in other extracellular fluids. Suc-Ala-Phe-Lys-AMC acetate salt has been shown to be effective in treating diseases caused by low blood sugar levels, such as diabetes mellitus type 2. Studies have also shown that it can be used to monitor the progress of metabolic disorders such as obesity and type 2 diabetes mellitus.</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>

<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>

<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The trifluorophenylboronic acid is a boronic acid that has been used in the synthesis of vitamin B12. This compound is often used as a catalyst for the Suzuki coupling reaction. It can also be used to synthesize amides and synthons. The trifluorophenylboronic acid is soluble in water, ethanol, and acetone. The pH of the solution depends on the type of base added. For example, when an amine is added to the solution, it increases to approximately 8-9. When a p-hydroxybenzoic acid is added to the solution, it decreases to approximately 2-3.</p>

<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>

<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Biotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aminocaproic acid is a non-specific lysing agent that is used in the treatment of acute blood clots. Aminocaproic acid has minimal toxicity and low-dose effects, and can be used for the treatment of thrombotic disorders. It also has biological properties that are different from those of aminocaproate, which can lead to a more rapid dissolution of the clot. Aminocaproic acid is an organic compound that belongs to the class of dicarboxylic acids. It is synthesized from two molecules of aminoacetic acid by the enzyme aminocaproic acid synthetase. The synthesis occurs in a two-step process: first, caprylic acid reacts with ATP to form aminopropyl-adenylate (APA), followed by hydrolysis by APA lyase to form aminocaproic acid.</p>

<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br&gt;br&gt;<br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>

<p>Acetate salt</p>

<p>Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).</p>

<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5'-Chloro-2'-hydroxy-3'-nitro-[1,1'-biphenyl]-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>

<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>

<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>

<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>

<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br&gt;br&gt; Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>

<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>

<p>cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl is a chemical compound that is used in research and industry. It is an efficient isomer of 4-aminocyclohexanecarboxylic acid methyl ester hydrochloride. cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl has been used as a model for the study of glimepiride, an insulin secretagogue, and has been shown to be active against Toxoplasma gondii.</p>

<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>

<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>

<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>