
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
4-(Piperidin-4-yl)benzoic acid hydrochloride
CAS:<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16ClNO2Purity:Min. 95%Molecular weight:241.71 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>Formula:C25H42N10O11SPurity:Min. 95%Molecular weight:690.73 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4BF4NO2Purity:Min. 95%Molecular weight:208.91 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol5,7-Docosadiynoic acid
CAS:<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>Formula:C22H36O2Purity:Min. 95%Molecular weight:332.52 g/mol4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester
CAS:<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12BrNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:302.12 g/molAmylin (free acid) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H260N50O56S2Purity:Min. 95%Molecular weight:3,904.27 g/molN-(2-Pyridyl)oxamic acid
CAS:<p>N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.</p>Formula:C7H6N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.13 g/moltert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate
CAS:<p>tert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate is a chiral compound that contains two stereogenic centers. It is a racemate of enantiomers. The enantiomeric purity can be determined by the preparative method. This compound is soluble in water and is stable in neutral or acidic conditions. It has been shown to act as an α-amino acid and to inhibit glycine uptake by neurons.</p>Formula:C21H23NO4Purity:Min. 95%Color and Shape:SolidMolecular weight:353.41 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molGlycodehydrocholic acid
CAS:Controlled Product<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>Formula:C26H37NO6Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:459.58 g/molMethyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate
CAS:<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
CAS:<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>Formula:C12H15NO4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:273.71 g/molIsopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate
CAS:<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H16N4O3Purity:Min. 95%Molecular weight:252.27 g/mol4-[2-[[(1S)-1-(2-Aminophenyl)-3-methylbutyl]amino]-2-oxoethyl]-2-ethoxybenzoic acid
CAS:<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>Formula:C22H28N2O4Purity:Min. 95%Molecular weight:384.47 g/mol5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride
CAS:<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H12N2O4•HClPurity:Min. 95%Molecular weight:248.66 g/molThymopentin acetate salt
CAS:Controlled Product<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>Formula:C30H49N9O9Purity:Min. 95%Molecular weight:679.77 g/mol3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid
CAS:<p>3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.</p>Formula:C14H16O3Purity:Min. 95%Molecular weight:232.28 g/molN,N-Bis(carboxymethyl)-L-glutamic acid
CAS:<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>Formula:C9H13NO8Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.2 g/molα-MSH (11-13) (free acid) acetate salt
CAS:<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>Formula:C16H30N4O4Purity:Min. 95%Molecular weight:342.43 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purity:Min. 95%Color and Shape:PowderMolecular weight:702.71 g/mol2-(2-Naphthyloxy)propanoic acid
CAS:<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>Formula:C13H12O3Purity:Min. 95%Molecular weight:216.23 g/mol2-Bromopropionic acid benzyl ester
CAS:<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>Formula:C10H11BrO2Purity:Min. 95%Molecular weight:243.1 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Formula:C14H25ClN6O5Purity:Min. 95%Molecular weight:392.84 g/mol1-Adamantylphosphonic acid
CAS:<p>1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.</p>Formula:C10H17O3PPurity:Min. 95%Molecular weight:216.21 g/molTES
CAS:<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>Formula:C6H15NO6SPurity:Min. 95%Color and Shape:PowderMolecular weight:229.25 g/molLysergic acid hydrazide
CAS:Controlled Product<p>Lysergic acid hydrazide is a synthetic drug with an active form of lysergic acid. It is used in the synthesis of ergocryptine and other drugs. The compound can be synthesized using methyl alcohol, trifluoromethyl group, hydroxy group, skeleton, and C1-4 alkyl as reactants. Lysergic acid hydrazide can also be synthesized from an inorganic acid such as nitrous or oxoalkyl. This compound has been used as a pharmaceutical preparation for the treatment of psychotic disorders. Lysergic acid hydrazide has shown to have reactive amide groups that may react with organic amines to form neurotoxic compounds.</p>Formula:C16H18N4OPurity:Min. 95%Molecular weight:282.34 g/molDecanoyl-Arg-Arg-Leu-Leu-chloromethylketone trifluoroacetate salt
CAS:<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>Formula:C35H67ClN10O5Purity:Min. 95%Molecular weight:743.42 g/mol2-[(2,3-Dimethylphenyl)amino]nicotinic acid
CAS:<p>2-[(2,3-Dimethylphenyl)amino]nicotinic acid is an arylpropionic acid that has been designed for the treatment of cancer. It is a neutral compound that can be crystallized or sterilized and then injected or implanted into tissues. The compound can be used as a diagnostic tool to target specific tissues in the body by using iontophoresis or organic solvents. 2-[(2,3-Dimethylphenyl)amino]nicotinic acid interacts with chlorine ions to form a chloride derivative, which is then transported through the tissue. This process can be reversed by adding an acid solution to the tissue, which will cause the chloride ions to break down into hydrogen and chloride ions.</p>Formula:C14H14N2O2Purity:Min. 95%Molecular weight:242.27 g/mol3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester
CAS:<p>Please enquire for more information about 3-[2-Amino-3-(2-tert-butoxycarbonyl-ethoxy)-2-(2-tert-butoxycarbonyl-ethoxymethyl)-propoxy]-propionic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H47NO9Purity:Min. 95%Molecular weight:505.64 g/molD-(-)-3-Phosphoglyceric acid disodium
CAS:<p>D-(-)-3-Phosphoglyceric acid disodium is a homologue of D-glyceric acid and is used in the synthesis of phosphatidylcholine. It binds to the active site of phosphatases and prevents them from hydrolyzing phosphate groups, which are critical for the production of adenosine triphosphate (ATP). The chemical stability and the availability make this compound an excellent candidate for biochemical studies. D-(-)-3-Phosphoglyceric acid disodium has been shown to be essential in biological function, as it functions as a substrate for many metabolic pathways such as glycolysis, gluconeogenesis, pentose phosphate pathway, and fatty acid biosynthesis. The molecule is also involved in a number of biochemical reactions that are catalyzed by enzymes. Mutational studies have shown that organisms without this compound will not survive.</p>Formula:C3H5O7PNa2Purity:Min. 93%Color and Shape:White PowderMolecular weight:230.02 g/molSodium phenylacetate
CAS:Controlled Product<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>Formula:C8H7NaO2Purity:Min. 95%Color and Shape:PowderMolecular weight:158.13 g/mol2,4-Dihydroxybenzenesulfonic acid
CAS:<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>Formula:C6H6O5SPurity:Min. 95%Molecular weight:190.17 g/molN,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide
CAS:<p>N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide is a molecule that has an optimum concentration of 0.5 M. It has a hydrogen bond donor and acceptor and is optically active. This molecule displays fluorescence properties and is inorganic with a chloride acceptor group. N,N'-Bis(2,6-diisopropylphenyl)-3,4,9,10-perylenetetracarboxylic diimide has been shown to have high photostability and to be enhanced by light emission from a diode. This molecule also has carbonyl groups that are electron donors for the fluorescence process.</p>Formula:C49H50N6O4Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:786.96 g/molLinolenic acid - 85%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is found in plants, animals, and human cells. Linolenic acid has been shown to suppress the growth of cancer cells by inhibiting the production of linoleic acid, which can stimulate the growth of cancer cells. Linolenic acid has also been shown to cause skin reactions such as erythema and pruritus when applied topically or taken orally. Linolenic acid may be used for the treatment of ovarian follicles. In addition, linolenic acid has been shown to have an allergic response in humans when it is injected into the vein. It is important to note that linolenic acid can inhibit T-cell proliferation and cytokine production in a dose-dependent manner. Furthermore, linolenic acid inhibits lipopolysaccharide-induced acute lung injury in mice by reducing inflammatory cell infiltration and neutrophil activation.</p>Formula:C18H30O2Purity:Min. 95%Molecular weight:278.43 g/mol11-Keto fusidic acid
CAS:<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>Formula:C31H46O6Purity:Min. 95%Molecular weight:514.69 g/mol4-Acetamidobenzenesulfonic acid
CAS:<p>4-Acetamidobenzenesulfonic acid (4ABS) is an organic compound that is used as a sulfa drug. It is found in the filtrate of the chemical reaction between inulin and sulfamic acid. 4ABS acts as an amine catalyst for acyl transfer reactions. 4ABS also reacts with chloroethanol to form a primary amino group on a colloidal particle surface. This reaction has been shown to be reversible, where hydrochloric acid can react with 4ABS to form the corresponding sulfamic acid.</p>Formula:C8H9NO3SPurity:Min. 95%Molecular weight:199.23 g/molC-Type Natriuretic Peptide (32-53) acetate salt
CAS:<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>Formula:C93H157N27O28S3Purity:Min. 95%Molecular weight:2,197.6 g/molEthyl 4-formylpyrrole-2-carboxylate
CAS:<p>Ethyl 4-formylpyrrole-2-carboxylate is a chemical compound that is used as an intermediate in organic synthesis. The compound has been reported to have spectra at m/z (M+1) of 168, 156 and 140. It also has been reported to have yields of about 98% when synthesized from ethyl azidoacetate and ethyl bromoacetate. The mass spectra show the molecular ion peak at m/z of 168, 156 and 140 corresponding to the structure of ethyl 4-formylpyrrole-2-carboxylate. Furan, n-substituted furan, thiophene, acetamide and cyclization are other possible structures for this molecule.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/moltert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride
CAS:<p>Please enquire for more information about tert-Butyl 3-(aminomethyl)-1H-indole-1-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N2O2Purity:Min. 95%Molecular weight:246.31 g/molCromoglicic acid D5
CAS:<p>Please enquire for more information about Cromoglicic acid D5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6D5BrPurity:Min. 95%Color and Shape:PowderMolecular weight:473.40 g/mol5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid
CAS:<p>Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N5O3Purity:Min. 95%Color and Shape:White To Yellow To Dark Red SolidMolecular weight:301.3 g/mol7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid
CAS:<p>7-[(2S,3R)-3-Amino-2-methyl-azetidin-1-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-quinoline-3-carboxylic acid (ABT) is a drug that binds to bacterial enzymes and inhibits their ability to synthesize proteins. ABT is a conjugate of fluoroquinolone and an amino acid. As the drug is degradable by hydrolysis, it has been shown to be less toxic in Sprague Dawley rats than other fluoroquinolones. This drug has been used in diagnostic tests as a ligand for affinity ligands, but has not been approved for human use. The drug also possesses functional groups that are important for binding to reconstituted enzymes.br>br>ABT's ester linkages are degradable by hydrolysis and can be</p>Formula:C20H16F3N3O3Purity:Min. 95%Molecular weight:403.35 g/molDansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.</p>Formula:C28H32N6O9S·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:742.68 g/molMethyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-nitropyrido[1,2-a]benzimidazole-8-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H9N3O4Purity:Min. 95%Molecular weight:271.23 g/molDomoic acid
CAS:<p>Domoic acid is a neurotoxin that has been shown to induce neuronal death in vitro and in vivo. Domoic acid inhibits the activity of ligand-gated ion channels, which increases the cytosolic Ca2+ concentration. This toxin also induces mitochondrial membrane potential loss, causing apoptosis. Domoic acid binds to the NMDA receptor and blocks glutamate binding. It also inhibits ATP synthase by competing with ADP for binding sites on the enzyme's F1 portion. Domoic acid has low potency as a neurotoxin because it does not readily cross the blood-brain barrier or enter cells via passive diffusion.</p>Formula:C15H21NO6Purity:Min. 90 Area-%Color and Shape:Beige PowderMolecular weight:311.33 g/molKermesic acid
CAS:<p>Kermesic acid is a hydroxybenzoic acid that is used as a food dye. It can be found in some red wines and it is also used to color the eggs of a particular breed of chicken. The most common use for kermesic acid is as an oxidizing agent in a chromatographic method, which separates molecules based on their size. The oxidation catalyst used can vary, but often trifluoroacetic acid (TFA) is used. TFA reacts with the kermesic acid to form an octaketide, which has the chemical formula C8H6O3. This octaketide then reacts with another molecule of TFA to form two esters.</p>Formula:C16H10O8Purity:Min. 95%Molecular weight:330.25 g/molIsatin-5-sulfonic acid sodium salt dihydrate
CAS:<p>Isatin-5-sulfonic acid sodium salt dihydrate is a potent inhibitor of caspases. It has been shown to inhibit the activity of caspase-3 in vitro, thereby inhibiting apoptosis. Isatin-5-sulfonic acid sodium salt dihydrate has also been shown to increase survival rates in animal models of neurodegenerative diseases such as Parkinson's disease and Huntington's disease. Isatin-5-sulfonic acid sodium salt dihydrate may have neuroprotective effects by inhibiting the release of proinflammatory cytokines and nitric oxide, which are associated with neuronal death. This drug also inhibits monoamine oxidase A (MAO-A) and zymosterone B (ZVAD).</p>Formula:C8H4NNaO5S·2H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:285.21 g/mol2-Chlorobutyric Acid
CAS:Formula:C4H7ClO2Purity:>90.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:122.552-(4-Hydroxyphenyl)propionic Acid
CAS:Formula:C9H10O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:166.183,4-Dihydroxyhydrocinnamic Acid
CAS:Formula:C9H10O4Purity:>98.0%(GC)(T)Color and Shape:White to Brown powder to crystalMolecular weight:182.1816-Hydroxyhexadecanoic Acid
CAS:Formula:C16H32O3Purity:>98.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:272.434-Bromo-2-methylbenzoic Acid
CAS:Formula:C8H7BrO2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:215.05(Ethylenedithio)diacetic Acid
CAS:Formula:C6H10O4S2Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:210.26tert-Butyl Hydrogen Tetradecanedioate
CAS:Formula:C18H34O4Purity:>95.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:314.473,3-Dimethyl-2-oxobutyric Acid
CAS:Formula:C6H10O3Purity:>98.0%(T)Color and Shape:White or Colorless to Almost white or Almost colorless powder to lump to clear liquidMolecular weight:130.143-(4-Carboxyphenyl)propionic Acid
CAS:Formula:C10H10O4Purity:>98.0%(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:194.19cis-4-(tert-Butoxycarbonylamino)cyclohexanecarboxylic Acid
CAS:Formula:C12H21NO4Purity:>98.0%(GC)(T)Color and Shape:White to Almost white powder to crystalMolecular weight:243.303-Iodo-4-methoxybenzoic Acid
CAS:Formula:C8H7IO3Purity:>97.0%(GC)(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:278.05N-(4-Pentynyl)phthalimide, 97%
CAS:<p>N-(4-Pentynyl)phthalimide is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referen</p>Formula:C13H11NO2Purity:97%Color and Shape:White to yellow to pale brown, PowderMolecular weight:213.24Tricarballylic acid, 98%
CAS:<p>It is used as an alternative to DMDHEU (formaldehyde releasing cross- linking agent). This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item</p>Formula:C6H8O6Purity:98%Color and Shape:White to cream to pale brown, Crystals or powder or crystalline powderMolecular weight:176.12Strontium oxalate, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C2O4SrPurity:95%Color and Shape:White, Powder or lumpMolecular weight:175.64Methyl 1-methylpyrrole-2-carboxylate, 99%
CAS:<p>Methyl 1-methylpyrrole-2-carboxylate is used as chemical and organic Intermediates. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item c</p>Formula:C7H9NO2Purity:99%Color and Shape:Clear colorless to yellow to orange, LiquidMolecular weight:139.151-Cyclohexene-1-carboxylic acid, 97%
CAS:<p>1-Cyclohexene-1-carboxylic acid is an intermediate in benzoic acid anaerobic decomposition by methanogenic consortium. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The o</p>Formula:C7H10O2Purity:97%Color and Shape:Powder or crystalline powder or fused solid or clear liquid as melt, Colorless or white to pale cream or pale yellowMolecular weight:126.16Ethyl cyanoformate, 99%
CAS:<p>Ethyl cyanoformate is used as reagent in the preparation of N-substituted amindinoformic acid and ethyl-4-quinazoline -2-carboxylate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the leg</p>Formula:C4H5NO2Purity:99%Color and Shape:Clear or slightly turbid colorless, LiquidMolecular weight:99.091-Cyclohexene-1-acetic acid
CAS:<p>1-Cyclohexene-1-acetic acid used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU referenc</p>Formula:C8H12O2Molecular weight:140.18Ethyl tert-butylacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H16O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.21tert-Butyl cyanoacetate, 98%
CAS:<p>tert-Butyl cyanoacetate is used in the synthesis of vinylogous urea. It is also used as a new additive for the sugar nucleoside base coupling step en route to DAPD with improved -selectivity. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some</p>Formula:NCCH2CO2C(CH3)3Purity:98%Color and Shape:Liquid or viscous liquid, Clear colorless to white to yellowMolecular weight:141.17Ethyl trimethylacetate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H14O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:130.19N-(2-Hydroxyethyl)succinimide, 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H9NO3Purity:95%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powder or lumps or fused solidMolecular weight:143.14Methyl chlorodifluoroacetate, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C3H3ClF2O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:144.503-Nitrophthalimide, 98%
CAS:<p>3-Nitrophthalimide is a useful dye for biological research purposes. It is a nitro heterocyclic compounds found to exhibit potential antifungal activities. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label informatio</p>Formula:C8H4N2O4Purity:98%Color and Shape:Pale yellow to yellow, Crystals or powder or crystalline powderMolecular weight:192.13Sodium DL-lactate, 60% w/w aq. soln.
CAS:<p>Useful chiral synthon; building block for depsipeptides</p>Formula:C3H5NaO3Purity:60%Molecular weight:112.06o-Cresolphthalein complexone, indicator grade
CAS:<p>Indicator for complexometric titration of Mg, Ca, Sr and Ba. It is used as an alkaline earth metal ion indicator. Suggested to be colorless at pH 11, but turns pink in the presence of alkaline earth metals. Also utilized in an auto analyzer to determine serum calcium. This Thermo Scientific Chemical</p>Formula:C32H32N2O12Color and Shape:White to cream, PowderMolecular weight:636.61N-(4-Bromobutyl)phthalimide, 96%
CAS:<p>N-(4-Bromobutyl)phthalimide is used in organic synthesis and the production of pharmaceutical. It can react with 1-phenyl-piperazine to get N-[4-(4-phenyl-piperazin-1-yl)-butyl]-phthalimide. It is a useful synthesis reagent used to synthesize B-cyclodextrin derivatives. This Thermo Scientific Chemic</p>Formula:C12H12BrNO2Purity:96%Color and Shape:White to cream, PowderMolecular weight:282.14Cycloheptylacetic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H16O2Purity:99%Color and Shape:Clear colorless, LiquidMolecular weight:156.233-Acetoxy-2-butanone, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O3Purity:98%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:130.144-(Methoxycarbonyl)cyclohexane-1-carboxylic acid, 97%
CAS:<p>4-(Methoxycarbonyl)cyclohexane-1-carboxylic acid is used as pharmaceutical intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / i</p>Formula:C9H14O4Purity:97%Molecular weight:186.21Dimethyl fumarate, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H8O4Purity:99%Color and Shape:Crystals or crystalline powder or flakes, White to cream to pale brownMolecular weight:144.13n-Butylidenephthalide, (E)+(Z), 95%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C12H12O2Purity:95%Color and Shape:Clear, yellow, LiquidMolecular weight:188.23Methyl cyclopentanecarboxylate, 97%
CAS:<p>Methyl cyclopentanecarboxylate This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the</p>Formula:C7H12O2Purity:97%Color and Shape:Clear colorless to pale yellow, LiquidMolecular weight:128.17Hydantoin-5-acetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.</p>Formula:C5H6N2O4Purity:98%Color and Shape:Crystalline powder, WhiteMolecular weight:158.112-Phenylethyl acetate, 98%
CAS:<p>Phenylethyl acetate mantains the typical rose notes of Phenylethanol with a more intense honey profile which is perfect for fruit and alcoholic drink applications. It is used as a pharmaceutical intermediate and also it holds application in gas chromatography and liquid chromatography. This Thermo S</p>Formula:C10H12O2Purity:98%Color and Shape:Clear colorless, LiquidMolecular weight:164.205-Hexenyl acetate, 97%
CAS:<p>(4E,7Z)-4,7-Tridecadienyl acetate,a component of the sex pheromone was synthesized from 5-hexenyl acetate. CM of 5-decene with 5-hexenyl acetate is used to produce the insect pheromone. Used in olefin cross metathesis. This Thermo Scientific Chemicals brand product was originally part of the Alfa Ae</p>Formula:C8H14O2Purity:97%Color and Shape:LiquidMolecular weight:142.2N-Vinylphthalimide, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C10H7NO2Purity:99%Color and Shape:White to cream to pale yellow, Crystals or powder or crystalline powderMolecular weight:173.17Cyclopentanecarboxylic acid, 99%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C6H10O2Purity:99%Color and Shape:Liquid, Clear colorless to pale yellowMolecular weight:114.143-(3-Fluorophenyl)propionic acid, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C9H9FO2Purity:97%Color and Shape:White to cream or pale yellow, Crystals or powder or crystalline powderMolecular weight:168.17Adipic dihydrazide, 97%
CAS:<p>Adipic dihydrazide is used as a formaldehyde scavenger and reacts with formaldehyde, thereby preventing the volatilizing of formaldehyde in the air. It is also employed as a paint additive and coating additive. It is also used as an intermediate. Further, it is used for cross-linking water-based emu</p>Formula:C6H14N4O2Purity:97%Color and Shape:White to pale cream or pale yellow, Powder or crystalline powderMolecular weight:174.20Ammonium acetate, 97%
CAS:<p>Ammonium acetate is widely utilized as a catalyst in the Knoevenagel condensation. It is the primary source of ammonia in the Borch reaction in organic synthesis. It is used with distilled water to make a protein precipitating reagent. It acts as a buffer for electrospray ionization (ESI) mass spect</p>Formula:C2H7NO2Purity:97%Color and Shape:Crystals or powder or crystalline powder, WhiteMolecular weight:77.08Ref: 02-A16343
Discontinued productDehydroacetic acid, 98%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C8H8O4Purity:98%Color and Shape:Powder, White to cream or pale yellowMolecular weight:168.151-Naphthylacetic acid, 95%, may cont. up to 5% 2-isomer
CAS:<p>1-Naphthylacetic acid is used as a plant growth regulator and for plant tissue culture. It is used for the vegetative propagation of plants from stem and leaf cutting, abscission promoter and substrate for auxin inducers of specific plant enzymes. Further, it stimulates root formation in cuttings of</p>Formula:C12H10O2Purity:95%Color and Shape:White to cream to yellow or pale brown, Crystalline powder or powderMolecular weight:186.21Methyl 3-methoxythiophene-2-carboxylate, 97%
CAS:<p>This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Sci</p>Formula:C7H8O3SPurity:97%Color and Shape:White to pale brown, Crystals or powder or crystalline powderMolecular weight:172.20Isopropyl palmitate, tech. 85%
CAS:<p>Isopropyl palmitate is used to formulate and evaluate the suitability of pluronic lecithin organogels containing flurbiprofen for topical application and to characterize microemulsion systems of isopropyl palmitate, water and 2:1 Brij 97, and 1-butanol by different experimental techniques. This Ther</p>Formula:CH3(CH2)14CO2CH(CH3)2Purity:85%Color and Shape:Liquid, Clear colorlessMolecular weight:298.511-Methylindazole-3-carboxylic acid, 97%
CAS:<p>1-Methylindazole-3-carboxylic acid is used as important raw material and intermediate used in organic Synthesis, pharmaceuticals, agrochemicals and dyestuff. It is also used as a pharmaceutical adjuvant, Granisetron Impurity D. This Thermo Scientific Chemicals brand product was originally part of th</p>Formula:C9H8N2O2Purity:97%Color and Shape:Powder, White to creamMolecular weight:176.18Ref: IN-DA00IEB2
Discontinued product3-OXO-4-PHENYL-BUTYRIC ACID ETHYL ESTER
CAS:Formula:C12H14O3Purity:95%Color and Shape:LiquidMolecular weight:206.2378



