Amino Acids (AA)

<p>Please enquire for more information about H-His-Lys-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-b-cyano-L-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Fmoc-amino-10,11-dihydro-5H-dibenzo[a,d]-cycloheptenyl-2-oxyacetyl-DL-Nle-4- methyl-benzhydrylamide resin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Leu-Tyr-OH is a water soluble polymer that is produced by the enzymatic polymerization of L-leucine and L-tyrosine. This polymer is cytotoxic and has been shown to bind to DNA in the cell nucleus, as well as inhibit protein synthesis. H-Leu-Leu-Tyr-OH was developed as an alternative to polyethylene glycol (PEG) due to its low toxicity, high biocompatibility, and ability to be easily synthesized.</p>

<p>The compound Fmoc-D-Cys(Bzl)-OH is a chiral homologue of the protonated amino acid D-Cys. The configuration of the proton in this molecule has been determined by proton nmr experiments. This compound is synthesized from the racemic mixture by reductive amination and deprotonation with sodium borohydride. The reagents are an organophosphate and an ester, which react in order to form a new carbon-carbon bond. The postulated enantiomers are screened for their activity against phospholipase A2, which cleaves ester bonds on phospholipids. One enantiomer has been shown to have more potent activity than its counterpart, suggesting that it is the desired product.</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Please enquire for more information about 4-(Fmoc-hydrazino)-benzoylaminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Fluoro-2-methoxyphenylacetone is a chemical with a wide array of applications in research and industry. It is a versatile building block, useful intermediate, and reagent for organic synthesis. This compound has been used as a starting material in the synthesis of other compounds. CAS No. 1017082-10-8</p>

<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>

<p>Please enquire for more information about H-Ala-Ala-Pro-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-L-isoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ala-OMe is a serine protease inhibitor that binds to serine proteases, including chymotrypsin, trypsin, and elastase. The inhibition of these enzymes prevents the hydrolysis of proteins by these enzymes, which can lead to cell death. Z-Ala-Ala-OMe has been shown to inhibit the growth of bacteria in vitro and in animal models. This compound also showed an ability to inhibit the production of phosphite by immobilized subtilisin from Bacillus licheniformis (Bacillus subtilis) with a Km value of 0.5 mM</p>

<p>Boc-Phe-Phe-OH is a linker that is used to create homologues. It has been shown to be able to form supramolecular structures and encapsulate biomolecules, such as amino acids. The ester linkage of Boc-Phe-Phe-OH can be modified by the addition of a carboxylic acid, which can lead to changes in its fluorescence and magnetic properties. Boc-Phe-Phe-OH is primarily used as an intermediate for fluorescent probes or other molecules.</p>

<p>Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescence</p>

<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>

<p>Ac-Phe-pNA is a synthetic substrate that can be used to study the role of serine proteases in collagenolysis. It has been shown to have a high affinity for collagen, which makes it an excellent candidate for use as a probe for studying the interaction of proteases with collagen. This substrate binds to the enzyme and is cleaved by the serine protease at neutral pH. The reaction mixture turns yellow and fluoresces under UV light. Ac-Phe-pNA is reactive to epimastigotes and displays a ph optimum of 7.5.</p>

<p>Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.</p>

<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe1-psi(CH2NH)Gly2)-Nociceptin (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Gly-Phe-OH is a labile tripeptide molecule that has been synthesized. The tripeptide is synthesized by coupling the amino acid H-Glu to Gly-Phe and then adding an amide bond to form the peptide. This study of the structure of H-Glu-Gly-Phe-OH was done using techniques such as electrospray ionization, chromatographic methods, and proton nuclear magnetic resonance spectroscopy. The compound was found to be neutral in charge and stable at room temperature, but unstable under acidic conditions. It is also soluble in any buffer with a pH range from 2.0 to 12.0 and can be purified by column chromatography or preparative HPLC.</p>

<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (p-Amino-Phe6)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>

<p>Hippuryl-Phe-Arg-OH is a potent and selective inhibitor of angiotensin-converting enzyme (ACE) with a long duration of action. It has been shown to be a potentiator of captopril and enalaprilat in the biochemical validation for ACE inhibition. Hippuryl-Phe-Arg-OH has significant inhibitory activity against phosphatases such as carboxypeptidase A, phospholipase A2, and aminopeptidase N.</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>

<p>Please enquire for more information about Boc-Thr(Ile-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Tyr-Val-OH is a model system for the study of monoclonal antibodies that are unable to bind to antigen. It has been shown to inhibit the production of signal protein, which is involved in cell proliferation and differentiation. H-Tyr-Val-OH also inhibits cell factor, which is a key component in the immune system. H-Tyr-Val-OH has been used as an oxidation catalyst to destroy the human immunodeficiency virus (HIV). The drug binds to human macrophages and blocks the activity of ATP binding cassette transporter. This leads to inhibition of HIV infection by preventing HIV from entering cells, thus inhibiting its replication.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>

<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Methyl-4-nitro-1H-pyrazole-3-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val4)-Angiotensin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Lys-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fluorogenic dye targeting caspase 3</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>

<p>Please enquire for more information about Boc-Ala-Gly-Sar-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>8-Boc-3,8-diaza-bicyclo[3.2.1]octane is a functional group that can be used in the preparation of pharmaceutical preparations. It is insoluble in water and soluble in organic solvents. This compound has been shown to be effective in the treatment of neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease. 8-Boc-3,8-diaza-bicyclo[3.2.1]octane has also been shown to have protective effects against sae-cd induced cytotoxicity by upregulating the expression of antiapoptotic proteins Bcl2 and Bclxl, which are important for neuronal cell survival.</p>

<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LymnaDFamide-1 is a neuropeptide that belongs to the family of c-terminal peptides. It is a dipeptide with a sequence of L-Pro-Tyr-Asp-Arg-Ile-Ser-Asn-Ser-Ala-Phe. This peptide was found in the nervous system of invertebrates, where it is believed to play an important role in the regulation of neurotransmitter release. In mammals, LymnaDFamide has been detected in the brain and in the gallbladder. It may be involved in regulating feeding behavior and gastric motility.</p>

<p>Please enquire for more information about Fmoc-Tyr(SO2(ONeopentyl))-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>

<p>Z-Pro-Leu-Gly-NHOH is a proteolytic enzyme that hydrolyzes collagen, an extracellular matrix protein. It is used in the workstation to extract proteins from biological samples such as mesenteric tissue or holothuria. The immobilized enzyme is prepared and stored on the workstation. The sample is then extracted by adding hydroxamic acids in a liquified state and separating the mixture using size exclusion chromatography. The proteolytic activity of Z-Pro-Leu-Gly-NHOH can be measured by its ability to hydrolyze collagen under alkaline conditions.</p>

<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,2-Dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) is a sodium salt that has the ability to form surfactant bilayers. DPPC is a model system for studying biochemical reactions and the phase transition of lipid bilayers. This compound has been used to study the effects of various drugs on cell membranes in biochemical research. In addition, DPPC has been shown to have hypoglycemic effects in animal models as well as having an anti-inflammatory effect.</p>

<p>Please enquire for more information about (Fmoc-Glu70,Ala71·72,Lys74)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>

<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>

<p>Boc-Cys(Bzl)-OSu is a prodrug that is metabolized by esterases to form the active compound, boc-Cys(Bzl)-OH. This molecule inhibits matrix metalloproteinase (MMP) activity and can be used for the treatment of viral infections, such as hepatitis C and HIV. Boc-Cys(Bzl)-OSu has been shown to inhibit MMPs in a number of different ways including steric interactions with the active site of MMPs and by binding to the receptor protein for these enzymes. It also has antiviral activity against HIV and other viruses.</p>

<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>

<p>Please enquire for more information about 1-(2,4-Dihydroxy-5-methoxyphenyl)-2-(4-hydroxyphenyl)-3,3-dimethoxy-1-propanone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-S-trityl-D-cysteine (Fmoc-SC) is a modified amino acid that is used in the synthesis of biomolecules. It can be synthesized using a stepwise process, starting with the reaction between cysteine and trityl chloride. Fmoc-SC has been shown to inhibit mitochondrial membrane potential and cell growth in cancer cells. Additionally, it has pharmacokinetic properties that make it suitable for intravenous administration. Fmoc-SC can also be used to modify proteins by reacting with hydroxyl groups on lysine residues and other nucleophiles, as well as to inhibit histone deacetylases (HDACs), which are enzymes that regulate transcriptional activity.</p>

<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Glutaryl-Ala-Ala-Phe-4MbNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phe-Leu-OH is an enzyme that has been found to be involved in the synthesis of meningococcal disease. In addition, it has been shown to have diagnostic potential for the detection of this disease. The enzyme is expressed on the surface of meningococci and produces a protein antigen which can be detected by the presence of antibodies in patient serum. Phe-Leu-OH is also involved in the synthesis of Phe-Leu amide, which may inhibit binding of inhibitor molecules to membrane channels. This activity may be related to its ability to cause a decrease in ion flow across cell membranes.</p>

<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>

<p>Please enquire for more information about Kininogen-Based Thrombin Inhibitor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Asp(OtBu)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>