Amino Acids (AA)

<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-methoxy-4'-(gamma-carboxypropyloxy)-benzhydrylamine linked to Alanyl-aminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Phe-NH2·HCl is a peptide that has been shown to have antiviral and anticancer properties. It blocks the replication of viruses by interacting with the amino acid sequence on the virus’s outer layer, which prevents the virus from binding to cells. H-Leu-Phe-NH2·HCl has also been shown to have anticancer properties. This peptide stimulates cancer cells to produce proteins that are required for their growth and proliferation, leading to increased tumor size. The effectiveness of this drug is enhanced when combined with other cancer drugs, such as cisplatin or vinblastine. H-Leu-Phe-NH2·HCl also has an excellent safety profile and does not cause any toxicity in healthy cells or tissues.</p>

<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Bromophenylalanine is a chemical compound that can be used as a spectroscopic probe to study the dynamics of protein synthesis. It is derived from 4-bromobenzaldehyde, which is oxidized by hydrogen peroxide in the presence of cytochrome P450 reductase and NADPH, yielding 4-bromophenylalanine. This compound has been shown to inhibit protein synthesis by binding reversibly to the synthetase during its synthetic cycle. The binding of 4-bromophenylalanine inhibits the synthesis of peptides with a C-terminal amide group. This inhibition leads to a decrease in the amount of functional groups present in proteins and an increase in the amount of buffers. These effects have been demonstrated through modelling studies using both model organisms and buffer solutions.</p>

<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Phe-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Ser(SO3H)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Alanine methyl ester HCl is a compound that is used in wastewater treatment. It has been shown to inhibit the enzyme DPP-IV, which is associated with metabolic disorders. L-Alanine methyl ester HCl also has been shown to have antimicrobial activity against a number of bacteria, including methicillin resistant Staphylococcus aureus (MRSA). L-Alanine methyl ester HCl has been shown to have anti-inflammatory properties and can be used for the treatment of autoimmune diseases. This compound also has a significant effect on biological properties such as phase transition temperature and thermal expansion.</p>

<p>H-Trp-Gly-Tyr-OH is a carbohydrate binding molecule that has been shown to have an anhydrase activity. It also has sequences with homologous enzymes in other organisms, such as multienzyme and chromatographic enzymes. This molecule is soluble in water and insoluble in organic solvents. H-Trp-Gly-Tyr-OH binds to hemicellulosic carbohydrates and catarrhine carbonic anhydrase, which are found only in higher primates. Mutational analysis has shown that the H-Trp-Gly-Tyr-OH protein can be converted into a cyclopentadienyl derivative, which is not found in nature.</p>

<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>

<p>Please enquire for more information about pTH (13-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>

<p>Please enquire for more information about N-alpha-Fmoc-Ndelta-allyloxycarbonyl-L-ornithine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Bromo-5-methylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurotensin (NT) is a peptide hormone that belongs to the family of amides and is found in the stomach, small intestine, and central nervous system. NT is an agonist of the neurotensin receptor and binds to allosteric binding sites on the receptor. Neurotensin (NT) is modified by proteolysis, which may be due to its acidic residue at position 9. This modification leads to increased affinity for the neurotensin receptor binding site. The pharmacokinetic properties of NT are not well-understood as it has been shown to have both high lipophilicity and low plasma protein binding rates. Neurotensin (NT) receptors have been shown to be G protein coupled receptors with different subtypes, such as NT1, NT2A, NT2B, and NT3.</p>

<p>Please enquire for more information about Adrenomedullin (26-52) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a pro-apoptotic protein that belongs to the group of pseudo acids. It is able to induce apoptosis. Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) can induce neuronal death by activating caspases and apoptosis pathway, which are involved in the process of programmed cell death. This protein also has anti-inflammatory properties, which may be due to its ability to inhibit cyclase activity. Ac-Asp-Glu-Val-Asp (pseudo acid) has been shown to be present at physiological levels in the brain and heart, where it may play an important role in maintaining cell viability.</p>

<p>D-Tryptophan is an amino acid that is naturally produced by the human body and is also found in certain foods such as bananas, oats, and turkey. D-Tryptophan methyl ester hydrochloride is a synthetic form of this amino acid. It has been shown to inhibit cell growth and may have other physiological effects such as regulating mood or sleep patterns. This drug binds to the cavity of enzymes involved in the synthesis of proteins and nucleic acids, which prevents them from carrying out their normal functions. The binding constants for D-tryptophan methyl ester hydrochloride with these enzymes are stronger than those for natural d-tryptophan. The reaction solution was studied using UV absorption spectroscopy and showed that glycol ethers were more effective solvents than piperonal, which allowed for asymmetric synthesis. Molecular docking analysis has shown that D-tryptophan methyl ester hydrochloride binds to the enzyme cavity more tightly than</p>

<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>

<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>

<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val6,Ala7)-Kemptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cholecystokinin-33 (1-21) (porcine) H-Lys-Ala-Pro-Ser-Gly-Arg-Val-Ser-Met-Ile-Lys-Asn-Leu-Gln, Ser, Leu, Asp, Pro, His, Arg is a linker that can be used to form peptide conjugates. It can be used as a cell type specific carrier to transport therapeutics across the blood brain barrier. It has also been shown to have therapeutic effects on cells in culture.</p>

<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Leu-Gly-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-Phe-Phe-OH is a molecule that belongs to the class of imidazolidinones. It is synthesized by reacting an amide with an imine. This synthetic molecule has been shown to have antihypertensive effects in a model system for hypertension. H-Phe-Phe-Phe-OH does not have any isomeric forms, but it can be present as different isotopic forms. The constant of this molecule is 2.5 kcal/mol and the molecular weight is 226 g/mol.br&gt; <br>br&gt;<br>The molecules are represented by 3D structures, which show their spatial arrangements and interactions with other atoms in space. These structures can be calculated using molecular modeling techniques such as computational chemistry or quantum mechanics.br&gt;<br>br&gt;<br>Molecular modeling techniques have allowed researchers to design new molecules, predict their properties and evaluate their potential applications in medicine and other fields.</p>

<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Pra-OH is a chemical substance that inhibits the synthesis of proteins. It binds to the active site of enzymes, thereby blocking the formation of an enzyme-substrate complex and inhibiting enzyme activity. H-D-Pra-OH is an enzyme inhibitor that can be used to study protein synthesis in vitro. It is most effective on renal proximal tubules cells, where it inhibits potassium uptake by competitive inhibition with d-alanine. H-D-Pra-OH also inhibits the uptake of aziridine, which is a reactive substance that can cause cellular damage. The carbonyl group in this substance may react with other substances such as potassium dichromate, forming a chromium compound that can be seen under the microscope.</p>

<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Gly-Lys-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Met-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluoro-2-methoxyphenol is a fluorinating agent that is used in the manufacture of pharmaceuticals, plastics and pesticides. It has been shown to induce apoptosis in cultured cells by upregulating reactive oxygen species (ROS) and increasing mitochondrial membrane permeability, as well as inhibiting cellular physiology. 4-Fluoro-2-methoxyphenol also inhibits the production of ATP and may be toxic to cells by interfering with dinucleotide phosphate.</p>

<p>Please enquire for more information about Ac-Asp-Met-Gln-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AMC conjugated molecule targeting chymotrypsin-like peptidase, calpain I and II and papain, and Ti protease from E. coli</p>

<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>

<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br&gt;</p>

<p>Please enquire for more information about ([D8]Val7·10)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-DL-alanine is an amino acid that is also known as d-alanine. It is a precursor for the synthesis of other amino acids such as histidine, methionine, and arginine. N-Methyl-DL-alanine is found in the mitochondria of cells and plays a role in energy metabolism. It has been shown to be taken up by cells through an active transport process and can act as a competitive inhibitor of mitochondrial uptake. At physiological concentrations, N-methyl DL-alanine inhibits fatty acid oxidation by decreasing the activity of carnitine palmitoyltransferase I (CPT I) and enhancing lipid accumulation in the liver. N-Methyl DL-alanine has been shown to inhibit cycloleucin A production by acting as an inhibitor of fatty acid synthase (FAS).</p>

<p>Please enquire for more information about Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Gly-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Tyr-Ala-OH is a biochemical that is expressed in mammalian cells. It has been shown to activate enzymes and the production of proteins, which are essential for cell growth. Fmoc-Tyr-Ala-OH is also proteolytic and hydrolyzing, meaning it can be used to cleave proteins into smaller pieces. It has been shown to have acidic and neutral properties at different pH levels. This enzyme also has an inhibitory effect on the production of monoclonal antibodies in mcf-7 cells, which are derived from mouse mammary epithelial cells.</p>

<p>Please enquire for more information about 1-Boc-4-aminoindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-44) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>

<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>

<p>Bradykinin is a peptide with a variety of physiological effects. It is formed by the cleavage of kininogen by kallikrein, and it is involved in the regulation of vascular tone and blood pressure, as well as responses to pain and inflammation. Bradykinin stimulates the release of histamine from mast cells, which causes an inflammatory response. Bradykinin also has been shown to stimulate the release of leukotrienes, prostaglandins, and cytokines from human lung tissue. The interaction between bradykinin and its receptors has been studied extensively using in vitro assays. The conformational changes in this peptide have been characterized by spectroscopic studies such as nuclear magnetic resonance (NMR) and circular dichroism (CD). In addition, bradykinin can be detected using luminescence techniques such as chemiluminescence or bioluminescence. Studies have shown that micromolar concentrations of bradykinin</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-2-Cyanoethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-(H-Gly-Pro-Gly-Pro-amido)-9-[di-(3-sulfonylpropyl)amino]-benzo[a]phenoxazonium perchlorate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Leech Osmoregulatory Factor H-Ile-Pro-Glu-Pro-Tyr-Val-Trp-Asp-OH (LOF) is a polyunsaturated peptide that regulates osmotic pressure. It has been purified from the leech Hirudo medicinalis and can be used in diagnosis or treatment of eye disorders, such as diabetic neuropathy, or in the treatment of diseases associated with high blood viscosity. LOF binds to the surface of cells and induces changes in cell shape. The binding of LOF to receptors on the cell membrane triggers receptor binding and subsequent activation of ion channels. This leads to an increase in water permeability across the cell membrane and increases the glomerular filtration rate. LOF also binds to monoclonal antibodies that are specific for eye disorders or other conditions associated with high blood viscosity, which may be useful for diagnosis or treatment.</p>

<p>H-Leu-allyl ester·p-tosylate is an amide with immobilized amino groups. It is an optically active compound that can be cumulated and used for biomolecular chemistry. H-Leu-allyl ester·p-tosylate has been shown to inhibit the growth of fungi by inhibiting the synthesis of tenuazonic acid, a mycotoxin that is found in contaminated grains.</p>

<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>

<p>Please enquire for more information about LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3,5-Dibromo-Tyr1)-Leu-Enkephalin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br&gt;br&gt;br&gt;</p>

<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about 2-O-Benzyl-3-O-allyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Pro-NH2·2 HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Ala-Pro-Phe-SBzl is a synthetic peptide with a sequence similar to the signal peptide of procarboxypeptidase B2. It has been shown that Suc-Ala-Ala-Pro-Phe-SBzl can be used as a diagnostic tool for pancreatic cancer, because it is found in higher concentrations in the blood of patients with pancreatic cancer. This peptide also has an affinity for metal ions, which allows it to be used as a probe to detect the presence of these ions in solution. Suc-Ala-Ala-Pro-Phe-SBzl binds to human immunoglobulin G (IgG) and can be used in analytical methods that use x ray diffraction data.</p>

<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>

<p>Please enquire for more information about Mast Cell Degranulating (MCD) Peptide HR-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Tritylglycine is an acidic amino acid that can be protonated in a highly acidic environment. It has been shown to inhibit the growth of tumor tissue by inducing apoptosis and inhibiting protein synthesis. N-Tritylglycine is used as a reagent for analytical chemistry, where it is used to detect amines such as histamine and serotonin. N-Tritylglycine also has been shown to be potent inhibitor of kinesin.</p>

<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Bromo-2-fluoro-N-methylbenzamide is an impurity in the pharmaceutical drug nilutamide. It is a ligand that binds to the androgen receptor and inhibits the binding of dihydrotestosterone, reducing its effect on prostate cells. 4-Bromo-2-fluoro-N-methylbenzamide has been shown to have pharmacokinetic properties similar to nilutamide, which is a drug used for treating prostate cancer. This impurity is also found in small quantities in other drugs including cyclobutanone, 2-aminoisobutyric acid, and chloral hydrate. The elucidation of these impurities can help regulate the quality of pharmaceutical drugs.</p>