Amino Acids (AA)

<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Phe-Gly-OH is a hydrophobic amino acid. It has been shown to be present in human proteins, and it has been used as a marker for determining the sequence of amino acids in peptides. H-Met-Phe-Gly-OH is an acidic tripeptide that can be analysed using reversed phase high performance liquid chromatography (RPHPLC). This tripeptide is found in the peptide transporter, which transports amino acids across cellular membranes. The structural studies of H-Met-Phe-Gly-OH have revealed that this tripeptide has an alpha helix conformation, with two hydrogen bonds from the backbone amides to the backbone carbonyl groups.</p>

<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>

<p>Ac-Ala-Pro-Ala-pNA is a transition-state analog inhibitor of serine proteases. In the catalytic cleft, Ac-Ala-Pro-Ala-pNA mimics the carbonyl group and minimizes the active site serine. The hydroxyl group in this compound is responsible for its transition state buildup that leads to hydrolytic reactions. Acetal formation can be observed as an intermediate step in this reaction. Acetal formation occurs when a hydroxylic oxygen atom reacts with a terminal alkoxy or thiohydroxylic carbon atom on the reactant molecule. This reaction is catalyzed by enzymes such as alcohol dehydrogenase, acetaldehyde dehydrogenase, and acetyl transferase.</p>

<p>H-Asp-Asn-Gln-OH is a basic amino acid that is cleaved by endopeptidase to form H-Asp, H-Asn, and H-Gln. It is also cleaved by serine proteases to form the amino acid residues of arginyl, aspartyl, and glutamyl. The residue sequence can be determined through hplc analyses of microsomal proteins. This amino acid has been shown to have a regulatory effect on the metabolism of other amino acids in rat liver cells. Asparaginyl and glutamyl are essential for the synthesis of proproteins.</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylcyclohex-2-en-1-one is a chemical compound that is used in the synthesis of pharmaceuticals, pesticides, and other organic compounds. It has been shown to be effective against Dendroctonus species and other pests. 3-Methylcyclohex-2-en-1-one is synthesized from cyclohexanone by hydrogenation of the double bond at the 3 position. The reaction can be catalyzed by palladium complexes with acid complexing ligands, such as phosphines or amines. The product is then purified by distillation, crystallization, or recrystallization.</p>

<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Diethylamino-4-methylcoumarin is a fluorescence probe that can be used in applications such as the study of hydrogen bonding interactions. It is excited by laser light and emits a red-shifted fluorescent light. 7-Diethylamino-4-methylcoumarin is a hydroxyl group analogue of coumarin, which has been shown to have physiological effects on the liver cells. The absorption spectrum of 7-Diethylamino-4-methylcoumarin is sensitive to changes in pH and chemical stability. A decrease in pH increases the intensity of the emission while an increase in pH decreases the intensity of the emission. This compound can also be used to label nucleic acids during polymerase chain reactions (PCR) or for sample preparation before analysis using nuclear magnetic resonance spectroscopy (NMR).</p>

<p>Please enquire for more information about [(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Arg-Gly-Asp-Trp-OH is a cyclic peptide that has been shown to bind to staphylococcal cells, inhibiting their growth. The peptide was found to have proton binding and membrane interactions. This drug has shown efficacy in biological samples such as collagen and fibrinogen. H-D-Arg-Gly-Asp-Trp-OH also can be activated by a disulfide bond. It has been found to bind with monoclonal antibodies and model systems.</p>

<p>Please enquire for more information about Ac-Ala-Gln-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-α-Me-Ser(tBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Ala-Pro-Lys-pNA is a hybrid peptide that was expressed and purified from the gene product of the human serine protease, pancreatic elastase. It has been shown to have high salt and pH stability and predominately exists as a single polypeptide chain. Suc-Ala-Ala-Pro-Lys-pNA has been shown to enhance the immunofluorescence of inflammatory cells in vitro, suggesting it may be used as a therapeutic agent for inflammatory diseases. In addition, this hybrid peptide has also demonstrated protease activity.</p>

<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>

<p>Leptin tifluoroacetic acid (150-167) is a diagnostic agent that can be used to measure leptin in vivo. Leptin tifluoroacetic acid (150-167) is an agonist for the leptin receptor, which has been shown to have effects on locomotor activity, body weight and body mass index in animals. Leptin tifluoroacetic acid (150-167) has also been shown to have anti-inflammatory properties and may be of use in the treatment of bowel diseases such as inflammatory bowel disease or bowel disease. Leptin tifluoroacetic acid (150-167) binds with high affinity to human fat cells, allowing it to be used as a marker for fat cell differentiation and energy metabolism. The main function of leptin is regulation of food intake and energy expenditure by acting on receptors in the brain, liver, muscle and other tissues.</p>

<p>Please enquire for more information about FA-Arg-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Val-Phe-OMe is an efficient method for the synthesis of a benzyl ester, which is a precursor to the anti-leishmanial drug Z-Val-Phe. The reaction is carried out in chloroform in the presence of ethyl or benzyl esters and ammonium chloride. This methodology was developed to provide a systematic approach to synthesize this compound. The reaction proceeds through a serine protease catalyzed hydrolysis of the amide bond on the surface of leishmania. Kinetic data shows that Z-Val-Phe-OMe has an IC50 value of 0.87 μM for leishmania and is more active than Z-Val-Phe against L. major, L. mexicana, and L. braziliensis strains.</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-His-Phe-OH is a polypeptide that is used in the diagnosis of chronic kidney disease. It is synthesized by the chemical reaction between histidine and phenylalanine. H-His-Phe-OH has been shown to have a molecular weight of 4,000 Da, with a diameter of 5 nm. The binding constants for this molecule are 3.5 x 10^6 M^(-1), and its stability in biological fluids has been shown to be greater than 100 hours at pH 7.4, 37°C.</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-Ser-Hyp-Gly-Asp-Trp-OH is a cyclic hexapeptide with a high activity against platelets. It is an antagonist of the cyclic RGD sequence, which is present in fibrinogen, fibronectin, vitronectin and other proteins. This peptide binds to the n-terminal residue of these proteins and prevents them from binding to their receptors on the surface of platelets. H-Pro-Ser-Hyp-Gly-Asp-Trp-OH has been shown to be specific for human platelets and does not bind to erythrocytes or leukocytes.</p>

<p>Pyr-Gly-OH is a metabolite of the amino acid glutamate. It has been shown that this metabolite is formed by a non-enzymatic dehydration of glutamate. This compound has been shown to be effective in treating bowel disease and cancer, as well as stimulating the production of fibrinogen in the blood. Pyr-Gly-OH has also been found to have anti-inflammatory effects and an increased effect on glutamic receptors.</p>

<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Phe-Ala-Ala-Phe-pNA is a serine protease with natriuretic properties. It has been shown to have high salt and pH optima and to be reactive at physiological pH. Suc-Phe-Ala-Ala-Phe-pNA has been sequenced and found to have a carboxy terminal reactive site. There are eight cysteine residues in the amino acid sequence of this protease, four of which are in the reactive site. This protease also has vasoactive intestinal peptide (VIP) activity, which is involved in inflammatory diseases.</p>

<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>

<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>

<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>

<p>Please enquire for more information about p60 v-src (137-157) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methoxybenzyl chloride is a polymer conjugate that has the chemical formula C6H5CH2ClO. It reacts with hydroxy groups to form ester bonds. The compound was synthesized by reacting 3-methoxybenzyl chloride with hydrochloric acid in vitro, and the resulting product was found to have antimicrobial properties. In vivo studies have shown that this compound binds to receptors in rat striatal tissue. 3-Methoxybenzyl chloride also showed fluorescence properties when exposed to ultraviolet light and can be used for molecular modeling. Titration calorimetry has been used to study the thermal stability of this polymer conjugate.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>

<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Ala-Pro-bNA is a peptidase that hydrolyzes peptides. The peptidase has two catalytic domains, which are located at the N and C termini of the protein. The N-terminal domain contains an oligopeptidase motif that has been shown to be important for the hydrolysis of substrates with hydrophobic residues. The C-terminal domain contains a cavity, which is necessary for binding to substrate and catalysis. This catalytic domain also contains an acid substitution, which may contribute to its stability in acidic environments. A mutant form of Z-Gly-Ala-Pro-bNA was generated by changing the amino acid residue at position n from serine to asparagine, which led to an increase in thermostability and in catalytic activity.</p>

<p>Please enquire for more information about Z-Tyr-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Cys-Gly-OH is an amino acid sequence that has been evaluated for its interactions with other amino acids and proteins. It is a tripeptide heterocycle and can be found in the tissues of many organisms, including humans. H-Gly-Cys-Gly-OH can be found in bovine serum and has been shown to have reversed phase high performance liquid chromatography activity. This molecule also interacts with reversed phase high performance liquid chromatography, ion exchange, and tripeptides.</p>

<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>Please enquire for more information about C-Reactive Protein (CRP) (174-185) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prolactin-Releasing Peptide (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-His-Gly-OH is an amino acid that belongs to the class of peptide science. It is a protonated molecule with a histidine side chain, which has been shown to have enzyme inhibition properties. This amino acid has been used in model studies to determine the effect of acidic and basic ternary mixtures on the stability of proteins. H-Gly-His-Gly-OH has also been found to be effective as a chelate ring, which is a ring that binds metals such as iron and copper. Enzymes can form when this amino acid is present in solution with metal ions.</p>

<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Val13)-alpha-MSH (11-13) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Val-Val-OH is an enantiomer of H-Val-Gly-Thr-Phe, a linear model of the apical region of the Caco2 cell. It is also a monolayer that has hydrogen bonds with other molecules. Molecular modeling shows that H-Val-Val-Val-OH inhibits the uptake of glucose by Caco2 cells. The transport properties of this molecule are not well understood, but it may inhibit glucose transport in the small intestine by binding to glucose transporter 2 (GLUT2). Chromatographic methods have been used to analyze H-Val-Val-Val-OH and its inhibition on growth factor activity.</p>

<p>Pro-Phe-Arg-pNA·2 HCl is a kallikrein substrate used to assay the activity of activated Hageman factor, that is the plasma protein and a serine protease also known as coagulation factor XII.</p>

<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>

<p>Diethyl (5-phenylisoxazol-3-yl) phosphate is a chlorpyrifos analog that is detectable in the blood and urine. The compound has been detected in red blood cells, plasma, serum, and urine samples at levels of 10 to 50 μg/L. Diethyl (5-phenylisoxazol-3-yl) phosphate can be used as an analytical method for detecting chlorpyrifos residue on food products or in environmental samples. Diethyl (5-phenylisoxazol-3-yl) phosphate is transfected into human hepatoma cells and activated by carbamate or propanil. It inhibits cellular protein synthesis by binding to the 30S ribosomal subunit, preventing the formation of the initiation complex between aminoacyl tRNA and mRNA. This binding also prevents peptide bond formation between amino acids, leading to cell death.</p>

<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>

<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>

<p>Ac-Cys(farnesyl)-OH is a synthetic chemical that has been shown to inhibit the growth of cells. It inhibits the enzyme form of farnesyl protein transferase, which is involved in the synthesis of basic proteins. Ac-Cys(farnesyl)-OH also binds to and inhibits epidermal growth factor receptor, which plays an important role in cell proliferation. In addition, this compound has been found to have anti-cancer properties. Ac-Cys(farnesyl)-OH has been shown to reduce the frequency of cellular transformation in vitro and in vivo. This effect may be due to its ability to inhibit protease activity.</p>

<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>

<p>Please enquire for more information about (d(CH2)51,Tyr(Et)2,Val4,Arg8,des-Gly-NH29)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>