
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,466 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38249 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is a protein that regulates muscle cell assembly and interactions. Disulfide bonds are formed by the oxidation of two cysteine molecules, which can be found in the extracellular matrix (ECM). The protein is an important regulator of metalloproteinases, which are enzymes that regulate ECM turnover. When disulfide bond lacks, it causes a deficiency in collagen production. Disulfide bond also has interactions with MMP-2, which plays a role in the regulation of arteriosclerosis and genetic disorders such as muscular dystrophy.</p>Formula:C52H71N13O14S2Purity:Min. 95%Molecular weight:1,166.33 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS:<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>Formula:C13H10N2O3SPurity:Min. 95%Molecular weight:274.3 g/molBoc-Ser(Ile-Fmoc)-OH
CAS:<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molFmoc-Homophe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Homophe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-D-Asp-OH
CAS:<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N5O5Purity:Min. 95%Molecular weight:289.29 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H203N37O32Purity:Min. 95%Molecular weight:2,700.15 g/molH-Asp(Phe-OH)-OH
CAS:<p>Aspartame is a synthetic, sweetener that is used as a sugar substitute in diet products. It was discovered by accident in 1965 when James Schlatter, a chemist of G.D. Searle Company, was testing an anti-ulcer drug and l-phenylalanine methyl ester on his finger and tasted the sweetness on his fingers. Aspartame is composed of two amino acids: aspartic acid and phenylalanine. The aspartic acid is made up of a carboxylic acid group with an amide functional group. Aspartame can be found in many foods including chewing gum and diet sodas. It has been shown to have no carcinogenic effects or adverse effects on reproduction function in animal studies.</p>Formula:C13H16N2O5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:280.28 g/molBombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/mol(Met(O2)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O2)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O62SPurity:Min. 95%Molecular weight:4,546.04 g/molSuc-Ala-Ala-Val-Ala-pNA
CAS:<p>Suc-Ala-Ala-Val-Ala-pNA is a synthetic peptide that is structurally similar to the natural peptide Vasoactive Intestinal Peptide. The amino acid sequence of this peptide is identical to that of the natural peptide with the exception of two additional amino acids, Ala and Val. Suc-Ala-Ala-Val-Ala-pNA has been shown to have vasoactive properties and it can be used for the treatment of inflammatory diseases such as Crohn's disease. This peptide has also been shown to inhibit protease activity by binding to the reactive site on serine proteases, which are involved in the degradation of extracellular proteins.</p>Formula:C24H34N6O9Purity:Min. 95%Molecular weight:550.56 g/molZ-Thr(tBu)-OSu
CAS:<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N2O7Purity:Min. 95%Molecular weight:406.43 g/mol(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.</p>Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molZ-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>Formula:C18H23N3O6Purity:Min. 95%Molecular weight:377.39 g/mol(3,4-Dehydro-Pro3)-Tuftsin
CAS:<p>Please enquire for more information about (3,4-Dehydro-Pro3)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H38N8O6Purity:Min. 95%Molecular weight:498.58 g/molH-Asn-Pro-Glu-Tyr(PO3H2)-OH
CAS:<p>Please enquire for more information about H-Asn-Pro-Glu-Tyr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H32N5O12PPurity:Min. 95%Molecular weight:601.5 g/mol(Pyr 6,Pro9)-Substance P (6-11)
CAS:<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>Formula:C39H53N7O7SPurity:Min. 95%Molecular weight:763.95 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/mol2-Bromo-5-hydroxy-4-methoxybenzaldehyde
CAS:<p>2-Bromo-5-hydroxy-4-methoxybenzaldehyde is a death pathway inhibitor that has been shown to have radiosensitizing effects in vitro. It has also been found to inhibit the expression of matrix metalloproteinase (MMP) in human glioma cells and in a rat model of cerebral ischemia. This compound may be used as a potential chemotherapeutic agent for the treatment of cancer. 2-Bromo-5-hydroxy-4-methoxybenzaldehyde inhibits cell proliferation by inducing apoptosis, or programmed cell death, which may be due to its ability to suppress MMP activity.</p>Formula:C8H7BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:231.04 g/molSapecin
CAS:<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>Formula:C164H266N58O52S6Purity:Min. 95%Molecular weight:4,074.62 g/molFmoc-D-Glu(OtBu)-OH
CAS:<p>Fmoc-D-glu(OtBu)-OH is a homologous molecule that binds to the influenza virus and inhibits its replication. The synthesis of Fmoc-D-glu(OtBu)-OH is achieved by solid-phase peptide synthesis, which involves the ligation of amino acid building blocks on an insoluble carrier resin. This process has been found to be effective for the synthesis of peptides with a variety of amino acid sequences. Fmoc-D-glu(OtBu)-OH has been shown to inhibit the growth and multiplication of Chlorella pyrenoidosa, a single celled green alga, and Paramecium tetraurelia, a protozoan ciliate. It also displays antimycobacterial activity against Mycobacterium tuberculosis in vitro.</p>Formula:C24H27NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:425.47 g/molN-Boc-(3S)-3-phenyl-3-aminopropionaldehyde
CAS:<p>N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is a synthetic chiral ligand that can be used as a building block in the synthesis of other compounds. It has been used to optimize the synthetic process, and it can be used in buffers, ammonium formate, metal chelate, and other additives to synthesize new compounds. N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is an optical isomer that can be used for supercritical fluid chromatography (SCFC) or liquid chromatography (LC). This compound has been shown to have a high affinity for ligands with a phenol group.</p>Formula:C14H19NO3Purity:Min. 95%Molecular weight:249.31 g/molPhacolysine sodium salt
CAS:<p>Phacolysine sodium salt is a drug that activates the choroidal neovascularization receptor. It has been shown to inhibit the growth of tumors by synchronous fluorescence and disulfide bond binding. Phacolysine sodium salt has shown clinical efficacy in the treatment of choroidal neovascularization, with an average success rate of 75%. It has also been shown to be effective in treating other types of cancer, such as prostate cancer. In addition, it has antioxidative properties and can inhibit prostaglandin synthesis. This medicine is sometimes used in combination with ondansetron hydrochloride and benzalkonium chloride for pharmacological treatment.</p>Formula:C18H10N4Na2O6S2Purity:Min. 95%Color and Shape:Red PowderMolecular weight:488.41 g/molBz-DL-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25N5O4·HClPurity:Min. 95%Molecular weight:471.94 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molAllatotropin
CAS:<p>Allatotropin is a diagnostic agent that belongs to the class of antimicrobial peptides. It has been shown to have strong activity against Gram-positive and Gram-negative bacteria. Allatotropin inhibits the growth of bacteria by binding to the external membrane, disrupting its integrity. Allatotropin also has been shown to increase gamma-aminobutyric acid levels in brain tissue and galleria mellonella larvae when injected subcutaneously. This may be due to its ability to activate GABA receptors. Allatotropin can be synthesized in vitro by combining β-amino acids with fatty acids and terminal residues, such as lysine, arginine, and glutamine, under conditions that mimic those found in living cells. This synthetic process yields a mixture of allatotropins with varying chain lengths and amino acid sequences.</p>Formula:C65H103N19O17S2Purity:Min. 95%Molecular weight:1,486.76 g/molFibronectin CS-1 Fragment (1978-1982)
CAS:<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>Formula:C26H45N5O10Purity:Min. 95%Molecular weight:587.66 g/molAlarin (human) trifluoroacetate salt
CAS:<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formula:C127H205N43O35Purity:Min. 95%Molecular weight:2,894.26 g/mol4-Formyl-phenyloxymethyl polystyrene resin (200-400 mesh)
<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>Purity:Min. 95%RFRP-3 (rat)
CAS:<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H134N26O25S2Purity:Min. 95%Molecular weight:2,020.3 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molH-Ala-Pro-Gly-OH
CAS:<p>Glycine is a small, sweet-tasting amino acid that is used in the biosynthesis of proteins. It has three linkages: an amide linkage to proline, and an ester linkage to alanine. The l-glycine molecule exists as two possible tautomers, the enol and keto forms. The enol form predominates at physiological pH; however, at very low pH, the keto form predominates. Glycine also has a cyclic structure and can be classified as a tripeptide.</p>Formula:C10H17N3O4Purity:Min. 95%Molecular weight:243.26 g/moltrans-4-Benzyloxy-3-methoxy-β-nitrostyrene
CAS:<p>Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.</p>Formula:C16H15NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:285.29 g/mol2,4-Dichloro-5-methoxyaniline
CAS:<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>Formula:C7H7Cl2NOPurity:Min. 95%Color and Shape:White To Pink SolidMolecular weight:192.04 g/mol2-O-Benzyl-3-O-allyl-sn-glycerol
CAS:<p>Please enquire for more information about 2-O-Benzyl-3-O-allyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18O3Purity:Min. 95%Molecular weight:222.28 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molH-Gly-Arg-Gly-Asp-Ser-OH TFA salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-OH TFA salt is a synthetic peptide that is designed to bind to the nuclear factor kappa B (NFκB) and inhibit its activation. NFκB is a transcription factor that regulates gene expression in response to various stimuli, including proinflammatory cytokines, oxidants, and electrophilic compounds. H-Gly-Arg-Gly-Asp-Ser-OH TFA salt has been shown to inhibit NFκB activation in a model system. This molecule also inhibits axonal growth and pluripotent cells differentiation, which may be due to its suppression of the signal peptide. The rate constant for this drug has been measured using polymer compositions and biocompatible polymers.</p>Formula:C17H30N8O9(freebase)Purity:Min. 95%Molecular weight:490.47 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/molChemotactic Domain of Elastin
CAS:<p>Chemotactic domain of elastin is a peptide with chemotactic activity. It is an amino acid sequence derived from the elastin protein, which is a major component of the extracellular matrix in connective tissue. Chemotactic domain of elastin has been shown to be a receptor molecule that binds to cells and induces chemotaxis. The chemotactic domain of elastin is also found in vivo and can be used as a model system for studying the behavior of cells in tissues. Structural analysis of this peptide has shown it to have an intramolecular hydrogen bond, which may explain its ability to withstand harsh conditions such as heat and pH changes.</p>Formula:C22H38N6O7Purity:Min. 95%Molecular weight:498.57 g/molZ-Lys(Z)-Ser-OH
CAS:<p>Please enquire for more information about Z-Lys(Z)-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H31N3O8Purity:Min. 95%Molecular weight:501.53 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molH-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Formula:C15H24N6O2Purity:Min. 95%Molecular weight:320.39 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol(D-Ser4)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molH-Ala-Ala-Ala-Tyr-OH
CAS:<p>H-Ala-Ala-Ala-Tyr-OH is a peptidic substrate that is used in assays to measure the activity of proteases. It has been shown to be a good substrate for neutrophil elastase and can be used to measure the activity of this enzyme. H-Ala-Ala-Ala-Tyr-OH has also been shown to be a reference compound for fluorescence measurements, which can be used for labeling or profiling. The fluorescence emission spectrum is constant over a wide range of pH and ionic strength, making it an ideal substrate for measuring protease activity.</p>Formula:C18H26N4O6Purity:Min. 95%Molecular weight:394.42 g/molH-Ser-Gln-Asn-Phe-psi(CH2NH)Pro-Ile-Val-Gln-OH
CAS:<p>Please enquire for more information about H-Ser-Gln-Asn-Phe-psi(CH2NH)Pro-Ile-Val-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H67N11O12Purity:Min. 95%Molecular weight:918.05 g/molRVG-9R trifluoroacetate salt
CAS:<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C201H334N82O55S2Purity:Min. 95%Molecular weight:4,843.45 g/molHIV (gp120) Fragment (421-438) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H148N24O25S2Purity:Min. 95%Molecular weight:2,138.51 g/mol(N-Me-D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about (N-Me-D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N15O11Purity:Min. 95%Molecular weight:1,124.29 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H82N16O11S3Purity:Min. 95%Molecular weight:1,167.47 g/mol(Tyr36)-pTH-Related Protein (1-36) amide (chicken)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H301N57O55Purity:Min. 95%Molecular weight:4,191.71 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/molMet-Lys-Bradykinin
CAS:<p>Met-Lys-Bradykinin is a synthetic peptide with the amino acid sequence Met-Lys-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg. It has been shown to have cytosolic Ca2+ release activity, protease activity, and vasodilator activities. The peptide also has binding affinity for human immunoglobulin G (IgG) and is able to form complexes with soybean trypsin.</p>Formula:C61H94N18O13SPurity:Min. 95%Molecular weight:1,319.58 g/molH-D-Lys(Z)-OMe·HCl
CAS:<p>H-D-Lys(Z)-OMe·HCl is a chemical compound that belongs to the group of organic nitrogen. It has been used in an experiment that monitored the population of a specific ecosystem. The experiment focused on the effects of organic nitrogen on the organisms living in this ecosystem. H-D-Lys(Z)-OMe·HCl was also used as a permission for an ecological research project, which focused on the behavioural patterns of animals in a natural environment. This compound has also been sponsored by science organisations, such as Ecological Society of America and Society for Experimental Biology.</p>Formula:C15H22N2O4·HClPurity:Min. 95%Molecular weight:330.81 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H41N9O9Purity:Min. 95%Molecular weight:671.7 g/molAnthranilyl-HIV Protease Substrate III trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H100N20O17Purity:Min. 95%Molecular weight:1,433.61 g/mol((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin
<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H69N11O14SPurity:Min. 95%Molecular weight:1,200.32 g/molH-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%TRAP-6 amide trifluoroacetate salt
CAS:<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>Formula:C34H57N11O8Purity:Min. 95%Color and Shape:PowderMolecular weight:747.89 g/molH-Ala-Ala-Ala-OMe acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H36N2O9Purity:Min. 95%Molecular weight:604.65 g/molH-Lys-Gly-Asp-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H27N5O8Purity:Min. 95%Molecular weight:405.4 g/mol4-(2',4'-Dimethoxyphenyl-Fmoc-aminomethyl)-phenoxymethyl-polystyrene resin (200-400 mesh)
<p>Please enquire for more information about 4-(2',4'-Dimethoxyphenyl-Fmoc-aminomethyl)-phenoxymethyl-polystyrene resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-b-Ala-Phe-Pro-OH
<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>Formula:C32H33N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:555.62 g/molNeuropeptide W-23 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C119H183N35O29SPurity:Min. 95%Molecular weight:2,600.01 g/molBoc-Met-Pro-OH
CAS:<p>Boc-Met-Pro-OH is a peptide that can be synthesized by condensation of the amino acid methanol with the carboxylic acid proline. This reaction yields Boc-Met-Pro-OH, which can be monitored via thin layer chromatography. The side chain on Boc-Met-Pro-OH is analogous to that of cholecystokinin and this class of peptides are derived from the amide bond. Condensation reactions catalyzed by papain or methyl esters result in the formation of an amide bond between two amino acids. These reactions also produce Boc-Met-Pro-OH because it has an amide bond.</p>Formula:C15H26N2O5SPurity:Min. 95%Molecular weight:346.44 g/molHCV Core Protein (107-114)
CAS:<p>Please enquire for more information about HCV Core Protein (107-114) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N16O12Purity:Min. 95%Molecular weight:997.07 g/molBoc-D-Phe-Pro-OSu
CAS:<p>Please enquire for more information about Boc-D-Phe-Pro-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O7Purity:Min. 95%Molecular weight:459.49 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H47FN6O14Purity:Min. 95%Molecular weight:914.89 g/molAc-D-Ala-D-lactic acid
CAS:<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H177N37O28Purity:Min. 95%Molecular weight:2,477.83 g/molSuc-Ala-Ile-Pro-Phe-pNA
CAS:<p>Cyclosporine is a cyclic peptide that is used as an immunosuppressive drug. It binds to the cytosolic protein phosphatase, preventing its activation. Cyclosporine also binds to other proteins in the cell, such as casein kinase II and cyclophilin, leading to changes in cellular function. It has been shown to inhibit the production of cytokines and other inflammatory mediators by inhibiting tyrosine kinase activity. Cyclosporine is metabolized into FK506, which has a similar structure but greater potency than cyclosporine. The mechanism of action for FK506 is not fully understood but it appears to be related to its ability to bind to tyrosine kinases and inhibit their activity.</p>Formula:C33H42N6O9Purity:Min. 95%Molecular weight:666.72 g/molH-Gly-Pro-Arg-Pro-NH2 acetate salt
CAS:<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>Formula:C18H32N8O4Purity:Min. 95%Molecular weight:424.5 g/mol3-Acetyl-1-methylpyrrole
CAS:<p>3-Acetyl-1-methylpyrrole is an activating agent that can be used to synthesize methyl ketones. It has been shown to react with acid solutions and proton, which are generated by the reaction of a metal ion (such as Al) with hydrochloric acid. This reaction leads to the formation of enolate ions, which can then react with carbonyl groups to form alkylation products. 3-Acetyl-1-methylpyrrole is also able to catalyze reactions in both acidic and basic conditions. The kinetic of this reaction is fast, efficient, and does not require expensive equipment.</p>Formula:C7H9NOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:123.15 g/molZ-D-Ala-D-Ala-OMe
CAS:<p>Please enquire for more information about Z-D-Ala-D-Ala-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molH-Gly-Gly-His-Ala-OH
CAS:<p>H-Gly-Gly-His-Ala-OH is a peptide of four amino acids. It has been shown experimentally that the side chain of His is always oriented in the same direction, regardless of the conformation. The proton shift constants and vicinal coupling constants for Gly, Gly and Ala are constant, while His has a variable proton shift constant. The experimental parameters for the molecule have been rationalized by using conformational shifts to explain their variability. For example, the proton shift constants have been found to be dependent on the rotation about an axis perpendicular to the peptide backbone. H-Ala-Gly-Gly-His-OH is a pentapeptide with five amino acids that differs from HGGHAOH by having Ala instead of His at position 1. The vicinal coupling constants are different and so are other experimental parameters.</p>Formula:C13H20N6O5Purity:Min. 95%Molecular weight:340.34 g/molH-Tyr-Tyr-Phe-OH acetate salt
CAS:<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>Formula:C27H29N3O6Purity:Min. 95%Molecular weight:491.54 g/mol(N-Me-Phe7)-Neurokinin B trifluoroacetate salt
CAS:<p>Please enquire for more information about (N-Me-Phe7)-Neurokinin B trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H81N13O14S2Purity:Min. 95%Molecular weight:1,272.5 g/molFmoc-Tyr(Boc-Nmec)-OH
CAS:<p>Fmoc-Tyr(Boc-Nmec)-OH is a hydrophobic amino acid that can be used in the synthesis of peptides. It is soluble in organic solvents and has been shown to have intramolecular cyclization reaction. Fmoc-Tyr(Boc-Nmec)-OH can be coupled with other amino acids using an amide bond, and has been shown to react with cationic groups such as tyrosine residues. This compound is often used in solid-phase peptide synthesis, where the product is cleaved from the resin by the action of aqueous acid or base before being purified. Fmoc-Tyr(Boc-Nmec)-OH can also be used for neutralizing alkaline conditions during peptide synthesis.</p>Formula:C34H39N3O8Purity:Min. 95%Molecular weight:617.69 g/molN-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid
CAS:<p>N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid is a high quality chemical that is used as an intermediate in the production of pharmaceuticals and other fine chemicals. It is also a reagent for use in peptide synthesis. N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid has a CAS No. 669073-62-5 and can be used as a useful scaffold for the production of complex compounds. This compound is also useful for research purposes, due to its versatility as a building block with speciality chemical applications.</p>Formula:C23H26N2O6Purity:Min. 95%Molecular weight:426.46 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13·C2HF3O2Purity:Min. 95%Molecular weight:1,310.34 g/molMet(O)14-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H282N50O61SPurity:Min. 95%Molecular weight:4,202.57 g/molH-Met-Leu-OH
CAS:<p>H-Met-Leu-OH is a peptide that is a protonated form of the amino acid, methionine. It has been shown to have transient activity in the pancreas and testes. H-Met-Leu-OH is also a substrate for a number of enzymes including peptidases, which cleave it into smaller molecules. The presence of H-Met-Leu-OH in polyacrylamide gels can be detected by photooxidation or by using an electrophoresis method. H-Met-Leu-OH is used as a marker to show the purity of proteins and peptides during solubilization and electrophoresis.</p>Formula:C11H22N2O3SPurity:Min. 95%Molecular weight:262.37 g/molH-Ala-Phe-Pro-pNA
CAS:<p>Please enquire for more information about H-Ala-Phe-Pro-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N5O5Purity:Min. 95%Molecular weight:453.49 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurity:Min. 95%Molecular weight:551.51 g/molTyr-α-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H276N52O51S2Purity:Min. 95%Molecular weight:3,952.48 g/molH-Arg-Leu-OH acetate salt
CAS:<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Leu6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molH-Asp(Leu-OH)-OH
CAS:<p>H-Asp(Leu-OH)-OH is a bioactive molecule that can induce apoptosis in cancer cells. Mechanistically, this compound induces apoptosis by increasing the amount of reactive oxygen species (ROS) and reducing mitochondrial membrane potential in cancer cells. The anti-cancer activity of H-Asp(Leu-OH)-OH has been shown to be dose dependent and it has been observed to cause vacuolization in kidney cells. Chemical compositions show that H-Asp(Leu-OH)-OH is composed of Aspartic acid, Leucine, and Hydroxyl groups.</p>Formula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/molH-Arg-Asn-NH2 sulfate salt
CAS:<p>Please enquire for more information about H-Arg-Asn-NH2 sulfate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H21N7O3Purity:Min. 95%Molecular weight:287.32 g/molLHRH (1-6) amide Pyr-His-Trp-Ser-Tyr-Gly-NH2
CAS:<p>Please enquire for more information about LHRH (1-6) amide Pyr-His-Trp-Ser-Tyr-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H42N10O9Purity:Min. 95%Molecular weight:758.78 g/molAngiotensin A trifluoroacetate salt
CAS:<p>Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH is a drug that has been shown to be effective in treating chronic kidney disease and heart failure. It is a synthetic peptide that mimics the activity of angiotensin II, an important regulator of blood pressure. Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH binds to the angiotensin receptor, which causes vasoconstriction and increases the release of soluble guanylate cyclase. This drug also inhibits the production of matrix metalloproteinases, which break down collagen and other extracellular proteins.</p>Formula:C49H71N13O10Purity:Min. 95%Molecular weight:1,002.17 g/molAc-Asp-Arg-Leu-Asp-Ser-OH
CAS:<p>Ac-Asp-Arg-Leu-Asp-Ser-OH is a peptide that has been synthesized to mimic the activity of aspartic acid. It has been shown to have prophylactic and/or therapeutic effects on infectious diseases and autoimmune diseases. Ac-Asp-Arg-Leu-Asp-Ser-OH may be used for the treatment of cancer, inflammatory diseases, and neurodegenerative diseases. Ac-Asp-Arg-Leu-Asp-Ser OH also acts as a cryoprotectant and diluent in drug development.</p>Formula:C25H42N8O12Purity:Min. 95%Molecular weight:646.65 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molAc-Tyr-Val-Ala-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Tyr-Val-Ala-Asp-aldehyde is a sesquiterpene lactone that has been shown to have anti-inflammatory properties. It inhibits the inflammatory response by inhibiting the production of pro-inflammatory cytokines and chemokines, such as IL1β, IL6, and TNFα. Ac-Tyr-Val-Ala-Asp-aldehyde also inhibits the activity of cyclooxygenase 2 (COX2) and lipoxygenase (LOX), which are enzymes that produce prostaglandins from arachidonic acid. Acetylsalicylic acid is an example of a drug with similar properties. Acetylsalicylic acid has been shown to inhibit the growth of cancer cells in tissue culture studies and in animal models. This compound may also be used to treat bowel disease, congestive heart failure, or other diseases that are characterized by increased apoptosis.</p>Formula:C23H32N4O8Purity:Min. 95%Molecular weight:492.52 g/molAc-Pen-Arg-Gly-Asp-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is an analytical method for the determination of the concentration-time curve. It is a cyclic peptide that competes with fibrinogen for binding to platelets. Disulfide bond has been shown to be an antagonist of receptor antagonist, and has potential applications in the treatment of autoimmune diseases. Disulfide bond can also be used as a model system for toxicological studies and experimental models in humans.</p>Formula:C22H36N8O9S2Purity:Min. 95%Molecular weight:620.7 g/molZ-Ala-Val-OH
CAS:<p>Z-Ala-Val-OH is a prodrug that is hydrolyzed to ala-z-valine in vivo. It has been shown to be resistant to enzymes such as esterases, amidases, and proteases. Z-Ala-Val-OH has been modified in an effort to increase its affinity for the active site of the enzyme. This modification involves attaching a hydrophobic group onto the amide nitrogen of the amino acid residue. The resulting product is an active ester that can be used as an antihypertensive drug or for the treatment of Alzheimer's disease.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molMca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H80N16O16Purity:Min. 95%Molecular weight:1,221.32 g/mol4-Methoxyphenyl boronic acid
CAS:<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:PowderMolecular weight:151.96 g/mol
