Amino Acids (AA)

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is a complex compound that is useful as a reagent for organic synthesis. It has been shown to be an effective intermediate in the synthesis of various compounds, such as peptides and pharmaceuticals. Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is also used as a building block for more complex molecules. This chemical has been shown to have high purity and quality, making it suitable for research purposes.</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Pro-Leu-Gly-NHOH is a proteolytic enzyme that hydrolyzes collagen, an extracellular matrix protein. It is used in the workstation to extract proteins from biological samples such as mesenteric tissue or holothuria. The immobilized enzyme is prepared and stored on the workstation. The sample is then extracted by adding hydroxamic acids in a liquified state and separating the mixture using size exclusion chromatography. The proteolytic activity of Z-Pro-Leu-Gly-NHOH can be measured by its ability to hydrolyze collagen under alkaline conditions.</p>

<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Gly-OH is a metabolite of the amino acid glutamate. It has been shown that this metabolite is formed by a non-enzymatic dehydration of glutamate. This compound has been shown to be effective in treating bowel disease and cancer, as well as stimulating the production of fibrinogen in the blood. Pyr-Gly-OH has also been found to have anti-inflammatory effects and an increased effect on glutamic receptors.</p>

<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV Core Protein (59-68) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>

<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>

<p>Please enquire for more information about 2-Chloro-3-methoxyphenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>

<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-L-isoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fmoc-Leu-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-L-leucine amide is a drug used to treat symptoms of depression in geriatric patients. It is an amide form of acetyl-L-leucine, which is an amino acid that plays a role in the synthesis of proteins and lipids. Acetyl-L-leucine amide has been shown to have antidepressant effects in geriatric patients with mild to moderate depression. This drug can be used as part of a combination therapy for infectious diseases, such as tuberculosis, when there is no infection or when resistance to other antibiotics has occurred. Acetyl-L-leucine amide has also been shown to be effective against cervical cancer and breast cancer cells. The synthesis of this drug involves two steps: first, reacting L-leucine with acetyl chloride; second, reacting the product with aqueous ammonia solution.</p>

<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (p-Amino-Phe6)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>

<p>Z-Lys(Z)-ONp is an intermediate in the synthesis of lysergic acid diethylamide (LSD). It is a hypotensive agent that has analgesic properties. Z-Lys(Z)-ONp has been patented for use as a hypotensive agent, although it has not yet been approved for this use.</p>

<p>Bradykinin (BK) is a peptide hormone that is released by the endothelium of blood vessels in response to injury. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is a synthetic version of the BK sequence with sulfate groups on the amino acids and an additional acid substitution. This molecule has been shown to be fully functional as a copolymer in thrombin activation, oligopeptide, and angiotensin production. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is stable at pH 3 and above, which makes it suitable for use in nutrient media, such as media for growing bacteria or yeast. It also has been shown to have platelet aggregation properties similar to those found in natural BK.</p>

<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>

<p>Please enquire for more information about Boc-Thr(Gly-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine L-malate is a chemical compound that is used in wastewater treatment. It inhibits the activity of enzymes such as carbon disulphide oxidase, copper complexes, and cationic surfactants. L-Lysine L-malate can be synthesized from sodium citrate and malonic acid by reacting with hydrogen peroxide to form a bicyclic heterocycle. This compound has been shown to have biological effects on metabolic disorders in animal studies, which may be due to its ability to inhibit the synthesis of fatty acids and proteins. The adsorption mechanism for this product is unknown.</p>

<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Atriopeptin III is a peptide hormone that belongs to the atrial natriuretic peptide group. It is an analog of atrial natriuretic peptide (ANP), which regulates blood pressure and sodium excretion, and has minimal toxicity. The disulfide bond between Cys-Cys and Cys-Gly on the N terminus of Atriopeptin III is necessary for its activity. The enzyme responsible for this disulfide bond formation is thioredoxin reductase, which is found in the cytoplasm of cells. Atriopeptin III has been shown to inhibit cyclase activity in renal proximal tubular cells, as well as congestive heart failure in rats. It also inhibits fatty acid synthesis by inhibiting carnitine acyltransferase I, leading to increased levels of free fatty acids and diacylglycerols in the blood plasma.</p>

<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Homo-L-tyrosine hydrobromide (HLTB) is a prodrug that is converted to L-3,4-dihydroxyphenylalanine (L-dopa) in vivo. It is used as an immunomodulator by stimulating the immune system and reducing inflammation. HLTB has been shown to have anti-inflammatory effects on the production of cytokines and chemokines, which are important for tumor growth and metastasis. HLTB is also known to inhibit tyrosine kinase, which plays a role in the development of some cancers.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>IGF-I (1-3) H-Gly-Pro-Glu-OH is a synthetic peptide that has been shown to be effective in treating neuronal death caused by glutamate. It binds to calcium ions and inhibits the activity of gamma-aminobutyric acid, which is an inhibitory neurotransmitter. IGF-I (1-3) H-Gly-Pro-Glu-OH also blocks fatty acid synthesis, leading to necrotic cell death. In vitro assays have shown that this drug can protect against blood group O erythrocytes from pyridoxal phosphate oxidation and protocatechuic acid binding. This drug has also been shown to increase locomotor activity in mice, as well as improve motor function in rats with experimental stroke.<br>IGF-I (1-3) H-Gly-Pro-Glu-OH is synthesized using a polymerase chain reaction technique and consists of amino acids 1 through 3 of</p>

<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is a synthetic chiral ligand that can be used as a building block in the synthesis of other compounds. It has been used to optimize the synthetic process, and it can be used in buffers, ammonium formate, metal chelate, and other additives to synthesize new compounds. N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is an optical isomer that can be used for supercritical fluid chromatography (SCFC) or liquid chromatography (LC). This compound has been shown to have a high affinity for ligands with a phenol group.</p>

<p>Please enquire for more information about Ac-muramyl-Ala-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Benzamidine is a benzamidase inhibitor that competitively binds to bacterial enzymes such as metalloendopeptidases and matrix metalloproteinases. It inhibits the degradation of collagen, resulting in a higher concentration of soluble extract. This drug also has an effect on spermatozoa, which may be due to its ability to inhibit bacterial enzymes that are involved with uptake and preload. Benzamidine has been shown to have a pH optimum of 8-9 and is most active at this pH range.</p>

<p>Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.</p>

<p>Please enquire for more information about Big Endothelin-1 fragment (22-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Fluoro-3-phenylpropan-2-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-D-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polistes mastoparan is a peptide that was extracted from the venom of the European beewolf. It has been shown to have high affinity for tumor cells and can be used as a diagnostic agent. Polistes mastoparan has also been shown to have anti-inflammatory properties and inhibit the formation rate of glycopeptide antibiotics. This peptide can bind to calmodulin, which may be due to its β-amino acid sequence. Polistes mastoparan inhibits the growth of Stenotrophomonas maltophilia in vitro by binding to fatty acids on the cell membrane.</p>

<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Ala-Ala-Tyr-OH is a peptidic substrate that is used in assays to measure the activity of proteases. It has been shown to be a good substrate for neutrophil elastase and can be used to measure the activity of this enzyme. H-Ala-Ala-Ala-Tyr-OH has also been shown to be a reference compound for fluorescence measurements, which can be used for labeling or profiling. The fluorescence emission spectrum is constant over a wide range of pH and ionic strength, making it an ideal substrate for measuring protease activity.</p>

<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>

<p>Please enquire for more information about H-Leu-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Type A Allatostatin I is a fatty acid that is synthesized in the liver and binds to the G protein-coupled receptor, alpha-MSH. Allatostatin I inhibits fatty acid synthesis and has been shown to have a protective effect on hepatic steatosis caused by methanol solvent exposure. It also has insecticidal properties which may be due to its ability to inhibit chitin synthesis in insects. Moreover, Type A Allatostatin I has shown ecological effects as an inhibitor of polymerase chain reactions (PCRs) for DNA replication. This compound also inhibits RNA synthesis in vitro at physiological levels. Type A Allatostatin I has been shown to be an endogenous factor that plays a role in obesity and diabetes, as well as its pathogenic mechanism.</p>

<p>Bz-Arg-betaNA·HCl is a fluorescent probe that binds to the active site of esterases. The fluorescence signal intensity is proportional to the amount of enzyme present and can be used for measuring the activity of esterases in vitro or in vivo. Bz-Arg-betaNA·HCl has been shown to have high specificity for esterases, with low affinity for other enzymes, such as proteases.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Z-D-Ala-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-cis-4-hydroxy-L-proline methyl ester is a synthetic molecule that can be used to synthesize amides. It is typically prepared through a multistep process that begins with the condensation of an acid chloride and an amine. The reaction product is then treated with methyl chloroformate to produce the desired compound, which can be purified by recrystallization. N-Boc-cis-4-hydroxy-L-proline methyl ester has been used in the synthesis of nucleophilic and reactive molecules, as well as industrial processes.</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ranamargarin H-Asp-Asp-Ala-Ser-Asp-Arg-Ala-Lys-Lys-Phe-Tyr-Gly-Leu-Met-NH2 is a compound that has been shown to bind to the dopamine receptor in rats. It has been shown to have low potency and is not active in clinical trials. Ranamargarin H-Asp-Asp-Ala-Ser--Asp--Arg--Ala--Lys--Lys--Phe--Tyr--Gly--Leu---Met---NH2 has also been shown to inhibit the production of dopamine in animals and humans, with a maximal response at concentrations of 10 nM. The biological properties of this compound are still being researched, but it appears that it can be used as a lead for developing new drugs for treating Parkinson's disease.</p>

<p>2-Phenylpyridine is a heterocyclic organic compound that has been shown to have x-ray crystal structures. It has redox potentials, nitrogen atoms, and a fatty acid group attached. 2-Phenylpyridine has been shown to have nmr spectra that are characteristic of a transfer reaction mechanism. The steric interactions and the biphenyl groups have been shown to have ancillary effects on the reaction mechanism. 2-Phenylpyridine is also known to coordinate in a geometric shape called octahedral, which is most likely due to hydrogen bonding and photophysical properties. The analytical chemistry of this molecule consists of determining its melting point, boiling point, and density. 2-phenylpyridine</p>

<p>Please enquire for more information about (Sar 1)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr69,Ala71·72,Lys74)-C3a (69-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about [(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Phe-Pro-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(SO3H)-OH sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-D-Alaninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>