
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,957 products)
- Amino Acid and Amino Acid Related Compounds(3,472 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38265 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N59O60SPurity:Min. 95%Molecular weight:4,421.82 g/molBoc-D-Phe-Pro-Arg-OH
CAS:<p>Boc-D-Phe-Pro-Arg-OH is a receptor binding molecule that belongs to the family of serine proteases. It has been shown to be reactive with multi-walled carbon nanotubes and fatty acids, making it useful for analytical chemistry, processing and amplification. The Boc-D-Phe-Pro-Arg-OH molecule binds to carbohydrate molecules in a way that mimics the action of an enzyme. This binding activates markers and triggers a reaction that produces hydrogen bonds between the target and the substrate. Boc-D-Phe-Pro-Arg-OH has been shown to have high affinity for serine protease receptors.</p>Formula:C25H38N6O6Purity:Min. 95%Molecular weight:518.61 g/molFmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH
CAS:<p>Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is a complex compound that is useful as a reagent for organic synthesis. It has been shown to be an effective intermediate in the synthesis of various compounds, such as peptides and pharmaceuticals. Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is also used as a building block for more complex molecules. This chemical has been shown to have high purity and quality, making it suitable for research purposes.</p>Formula:C35H34N6O7Purity:Min. 95%Color and Shape:PowderMolecular weight:650.68 g/molFmoc-Tyr(SO3H)-OH barium salt
CAS:<p>Please enquire for more information about Fmoc-Tyr(SO3H)-OH barium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO8SPurity:Min. 95%Molecular weight:483.49 g/molAc-Leu-Val-Phe-aldehyde
CAS:<p>Ac-Leu-Val-Phe-aldehyde is a synthetic compound that inhibits the catalytic activity of carboxyl enzymes. It binds to the catalytic site of the enzyme via a noncovalent interaction with residues on the polypeptide chain, thereby preventing the formation of an active complex with other cofactors such as metal ions, amino acids, and ATP. Ac-Leu-Val-Phe-aldehyde can be used in analytical chemistry for determination of carboxyl groups in organic compounds or for determining protein content in biological samples. Ac-Leu-Val-Phe-aldehyde has also been shown to bind to antibodies which are specific for carboxyl groups.</p>Formula:C22H33N3O4Purity:Min. 95%Molecular weight:403.52 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H179N35O28SPurity:Min. 95%Molecular weight:2,591.99 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H43FN4O11Purity:Min. 95%Molecular weight:654.68 g/molN-Me-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O2Purity:Min. 95%Molecular weight:319.44 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/mol3'-Hydroxy-4'-methoxyacetophenone
CAS:<p>3'-Hydroxy-4'-methoxyacetophenone is a chemical compound with the molecular formula CHO and it belongs to the group of bisbenzylisoquinoline alkaloids. It is a white crystalline powder that has a dry weight of 155.2g/mol and melting point of 154-158°C. 3'-Hydroxy-4'-methoxyacetophenone is used as an intermediate in the synthesis of other chemicals, such as methyl transferase inhibitors like metronidazole or oxidative stress agents like benzoquinones. 3'-Hydroxy-4'-methoxyacetophenone can be found in bowel disease patients, where it may be produced by bacteria in the gut. This chemical also has UV absorption properties and can be used as a sample preparation agent for hydroalcoholic samples.</p>Formula:C9H10O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.17 g/molUrinary Trypsin Inhibitor Fragment
CAS:<p>Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH is a synthetic peptide that is used as a diagnostic agent. It has been shown to inhibit proinflammatory cytokines in vitro and in vivo. This peptide binds to the amino acid sequences of phospholipase A2, which are found in tumor cells, and can be used for cancer diagnosis. Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH also binds to DNA methylation, which may be useful for studying DNA methylation patterns in cancer cells.</p>Formula:C40H66N14O9SPurity:Min. 95%Molecular weight:919.11 g/molSuc-Gly-Gly-Phe-pNA
CAS:<p>Suc-Gly-Gly-Phe-pNA is a colorimetric substrate for Chymotrypsin and Streptomyces griseus protease B. Activity is quantified by the release of p-nitroaniline which is measured by absorbance at 405 nm.</p>Formula:C23H25N5O8Purity:Min. 95%Molecular weight:499.47 g/molH-Ala-Pro-4MbetaNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H23N3O3·HClPurity:Min. 95%Molecular weight:377.86 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molZ-L-Alanine
CAS:<p>Z-L-Alanine is a cytosolic enzyme inhibitor that inhibits the activity of enzymes involved in protein catalysis. This inhibition is stereoselective, with the L-enantiomer having the stronger inhibitory effect. Z-L-Alanine has been shown to be an effective inhibitor of proteolytic enzymes and has been used as an additive in buffers to prevent enzymatic degradation. Molecular modeling studies have demonstrated that Z-L-Alanine can bind to the active site of these enzymes and inhibit their activity by binding to the catalytic triad of serine, aspartate, and histidine residues. The molecular structure of Z-L-Alanine resembles that of a natural substrate for these enzymes, which may account for its effectiveness in inhibiting them. FTIR spectroscopy has confirmed the presence of Z-L-alanine in a sample obtained from a bacterial culture. Liquid chromatography has shown that this amino acid is present at high levels in various</p>Formula:C11H13NO4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:223.23 g/mol3-Acetyl-1-methylpyrrole
CAS:<p>3-Acetyl-1-methylpyrrole is an activating agent that can be used to synthesize methyl ketones. It has been shown to react with acid solutions and proton, which are generated by the reaction of a metal ion (such as Al) with hydrochloric acid. This reaction leads to the formation of enolate ions, which can then react with carbonyl groups to form alkylation products. 3-Acetyl-1-methylpyrrole is also able to catalyze reactions in both acidic and basic conditions. The kinetic of this reaction is fast, efficient, and does not require expensive equipment.</p>Formula:C7H9NOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:123.15 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-L-Nitroarginine
CAS:<p>Boc-L-Nitroarginine is a nitric oxide synthase inhibitor that belongs to the class of drugs called nitric oxide inhibitors. It is a potent inhibitor of nitric oxide synthase, preventing the production of nitric oxide from arginine. The drug has been shown to have therapeutic effects in the treatment of cancer, diabetes mellitus, and other diseases. Boc-L-Nitroarginine inhibits tumor angiogenesis by blocking endothelial cell proliferation and migration. It also inhibits insulin secretion, leading to an improved glycemic control in diabetic patients. Boc-L-Nitroarginine can be used as a hydrogenation reducing agent for the synthesis of imatinib and palladium catalysts for hydrogenation reactions.</p>Formula:C11H21N5O6Purity:Min. 95%Color and Shape:PowderMolecular weight:319.31 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molZ-Phe-Arg-pNA·HCl
CAS:<p>Please enquire for more information about Z-Phe-Arg-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H33N7O6·HClPurity:Min. 95%Molecular weight:612.08 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molH-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH
CAS:<p>Please enquire for more information about H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N6O7Purity:Min. 95%Molecular weight:444.48 g/molH-Tyr-Lys-OH
CAS:<p>H-Tyr-Lys-OH is a small drug molecule that has been shown to inhibit protein synthesis. It binds to the active site of the transcription-polymerase chain and competitively inhibits the binding of RNA polymerase. H-Tyr-Lys-OH has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis. H-Tyr-Lys-OH's conformational properties are similar to those found in proteins such as glutamic acid and lysine.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molH-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>Formula:C17H29ClN4O4Purity:Min. 95%Molecular weight:388.89 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/molHCV-1 e2 Protein (484-499)
CAS:<p>The HCV-1 e2 protein (484-499) is a peptide that is a fragment of the HCV-1 e2 protein. It has been shown to be neuroprotective in vitro and in vivo, by inhibiting the production of reactive oxygen species and reducing cell death. The HCV-1 e2 protein (484-499) is also able to inhibit inflammatory responses in human pancreatic cells and fibrosis in autoimmune disease models. This peptide could be used as prophylaxis or treatment for neurodegenerative disease, pancreatic cancer, infectious diseases, autoimmune diseases, or fibrotic diseases.</p>Formula:C88H122N20O19S2Purity:Min. 95%Molecular weight:1,828.17 g/molH-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu-OH
CAS:<p>The target of H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-Pro-Ile-Tyr-Leu is the phosphotyrosine residue in tyrosine kinase. This compound has been shown to inhibit the proliferation of cells that express this type of receptor and induce apoptosis. The x-ray structures of ligand binding to the receptor show a hydrogen bond network with the hydroxyl group at position 2, which is believed to be important for binding activity. The molecular modeling studies confirm that this interaction is energetically favorable, with a ΔΔG = -6.5 kcal/mol. H-Glu-Pro-Gln-Tyr(PO3H2)-Glu-Glu-Ile-(OH) has also been found to have antiosteoporotic properties when administered orally in rats.</p>Formula:C66H97N12O24PPurity:Min. 95%Molecular weight:1,473.52 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molH-Arg-4MbetaNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Arg-4MbetaNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O2·xHClPurity:Min. 95%Molecular weight:365.86 g/molH-Ala-Ala-Ala-pNA·HCl
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21N5O5·HClPurity:Min. 95%Molecular weight:387.82 g/molN-Boc-1,2-phenyldiamine
CAS:<p>N-Boc-1,2-phenyldiamine is a histone acetyltransferase (HAT) inhibitor. It is an acetylated molecule that contains two phenyl rings, one of which is substituted with an amine group. This compound was designed to inhibit the activity of HATs, which are enzymes involved in the chemical modification of histones and other proteins. N-Boc-1,2-phenyldiamine inhibits the activities of these enzymes and prevents the acetylation of lysines on histones or other proteins. It has been shown to be efficient in inducing apoptosis in human cancer cells and may also have some antitumor effects.</p>Formula:C11H16N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.26 g/molZ-His-Phe-OH
CAS:<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H24N4O5Purity:Min. 95%Molecular weight:436.46 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Sarafotoxin C trifluoroacetate salt
CAS:<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>Formula:C103H147N27O37S5Purity:Min. 95%Molecular weight:2,515.76 g/molFmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molN-α-Fmoc-N-δ-Boc-D-ornithine
CAS:<p>N-alpha-Fmoc-N-delta-Boc-D-ornithine (NFDO) is an antibiotic that belongs to the group of macrocyclic, cyclic antibiotics. This drug has antibacterial activity against gram-negative pathogens and is most effective against E. coli. NFDO is synthesized by a solid phase synthesis that occurs in two stages: first, FMOC protected amino acids are coupled to the resin and then deprotection is carried out with piperidine in DMF at room temperature. The final product is obtained by cleavage of the peptide from the resin with trifluoroacetic acid and purification by HPLC.</p>Formula:C25H30N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:454.52 g/molH-Val-Ser-OH
CAS:<p>L-Threonine is an amino acid that belongs to the branched-chain family of amino acids. It is a nonessential amino acid, meaning that it can be synthesized by the human body. L-Threonine is one of the two amino acids (along with L-Serine) that has a hydroxyl group on the alpha carbon atom. It is also used in certain metabolic pathways such as sphingolipid metabolism and tryptophan metabolism. L-Threonine is used in experimental models for bowel disease and intestinal cancer, but its role in these conditions has not been determined. The molecule can be found in both animal and plant proteins, but most often it occurs in animal sources. The compound can also be found as a component of skin condition treatments or as an additive to shampoos, lotions, and cosmetics.</p>Formula:C8H16N2O4Purity:Min. 95%Molecular weight:204.22 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molFmoc-Thr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N12O13PPurity:Min. 95%Molecular weight:1,055.04 g/molH-Phe-Leu-Glu-Glu-Val-OH
CAS:<p>H-Phe-Leu-Glu-Glu-Val-OH is a synthetic amino acid molecule that is used as a substrate for protein synthesis. The solubilized and biochemically active H-Phe-Leu-Glu-Glu-Val-OH can be prepared by the reaction of glutamic acid with phenylalanine, leucine, and glycine. This product is an irreversible enzyme that has been conjugated to a linker to form a reversible linkage. A spectrometer can be used to analyze the chemical structure of this compound. It is soluble in water and has a molecular weight of 310. It contains two carboxyl groups and one amino group that are linked by amide bonds.</p>Formula:C30H45N5O10Purity:Min. 95%Molecular weight:635.71 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Formula:C8H16N2O3SPurity:Min. 95%Molecular weight:220.29 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O2·HClPurity:Min. 95%Molecular weight:297.78 g/molH-Gly-Leu-Leu-Gly-OH
CAS:<p>Please enquire for more information about H-Gly-Leu-Leu-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N4O5Purity:Min. 95%Molecular weight:358.43 g/molTrt-Met-OH·DEA
CAS:<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25NO2S·C4H11NPurity:Min. 95%Molecular weight:464.66 g/molG Protein Antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2
CAS:<p>G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2 is a synthetic peptide that inhibits the activity of cyclase enzymes. It has been shown to inhibit skin cancer cells and has been shown to bind intracellular targets, such as protein kinase C, with high affinity. G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp--Met--NH2 has also been shown to inhibit the guanine nucleotide binding proteins (G proteins), which are necessary for cell signaling. G protein antagonist Pyr--Gln--D--Trp--Phe--D--Trp--D---Trp---Met---NH2 may also be used as an inhibitor of neurokinin 1 receptor activation and whole cell recordings have shown this drug to be potent antagonists of α subunit. G protein antagonist Pyr--Gln--D</p>Formula:C57H64N12O9SPurity:Min. 95%Molecular weight:1,093.26 g/molH-Ser-Met-OH
CAS:<p>Glycyl-l-leucine is a muscle protein that belongs to the group of glycyl amino acids. It has been shown to have cortisone activity, which causes it to function as a suppressant. Glycyl-l-leucine binds to iron and prevents its oxidation, thereby preventing the formation of reactive oxygen species. Glycyl-l-leucine also has the ability to chelate iron, which can cause it to have antioxidant functions. The pH optimum for this compound is acidic and it is not active in neutral pH environments. This compound is found in fetal bovine serum and may be present in some food products such as chocolate milk or cheese. Glycyl-l-leucine may be used as an immobilizing agent for enzymes because it does not denature proteins at high concentrations.END></p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/molH-Met-Met-Met-OH
CAS:<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molZ-D-Orn (Z)-OH
CAS:<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H24N2O6Purity:Min. 95%Molecular weight:400.43 g/molAdrenomedullin (16-31) (human, pig)
CAS:<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H129N25O21S2Purity:Min. 95%Molecular weight:1,865.19 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O3SPurity:85%MinMolecular weight:292.35 g/molAc-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2
CAS:<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N7O6Purity:Min. 95%Molecular weight:842.04 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molNeurokinin B trifluoroacetate salt
CAS:<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br><br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>Formula:C55H79N13O14S2Purity:Min. 95%Molecular weight:1,210.43 g/molFA-Lys-Ala-OH
CAS:<p>FA-Lys-Ala-OH is a mutant enzyme that has an expressed constitutive mutation. It is a mutational variant of the wild type enzyme with an additive kinetic effect. The kinetic constants for this mutant were determined and correlated to determine the determinants of the mutations. This mutant has uncharged substitutions in its carboxypeptidase B active site, which changes its pH optimum from acidic to neutral values.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/molCoagulation Factor XIIIa (190-230)
CAS:Controlled Product<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C220H322N54O73Purity:Min. 95%Molecular weight:4,891.23 g/molCionin
CAS:<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>Formula:C53H63N11O19S3Purity:Min. 95%Molecular weight:1,254.33 g/mol(Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H72N16O12Purity:Min. 95%Molecular weight:1,221.33 g/molZ-Gly-Pro-Phe-Pro-Leu-OH
CAS:<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H45N5O8Purity:Min. 95%Molecular weight:663.76 g/molAc-Trp-NHMe
CAS:<p>Ac-Trp-NHMe is a hydrogen bond acceptor, which is a functional group that can form hydrogen bonds with other molecules. It is found in proteins and has been extensively studied by protein data bank. The amide group of Ac-Trp-NHMe forms a hydrogen bond with the carbonyl group of the amino acid tryptophan. The molecule has been used as a model system for studying the fluorescence properties of tryptophan, and to understand vibrational spectra. Ac-Trp-NHMe has also been shown to be an important chemical in plants, where it is involved in the formation of the dry weight of plants and water molecules.</p>Formula:C14H17N3O2Purity:Min. 95%Molecular weight:259.3 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H132N22O18S3Purity:Min. 95%Molecular weight:1,786.24 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molFmoc-Dap(Adpoc)-OH
CAS:<p>Please enquire for more information about Fmoc-Dap(Adpoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N2O6Purity:Min. 95%Molecular weight:546.65 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molFGF acidic I (102-111) (bovine brain)
CAS:<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H82N16O13Purity:Min. 95%Molecular weight:1,223.38 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Formula:C28H56NO7PPurity:Min. 95%Molecular weight:549.72 g/molH-Asp-Asp-Asp-OH
CAS:<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>Formula:C12H17N3O10Purity:Min. 95%Molecular weight:363.28 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Formula:C26H31N5O6Purity:Min. 95%Molecular weight:509.55 g/molAcetyl-Pepstatin Ac-Val-Val-Sta-Ala-Sta-OH
CAS:<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br></p>Formula:C31H57N5O9Purity:Min. 95%Molecular weight:643.81 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molBoc-Phe-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Phe-bNA
CAS:<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>Formula:C21H21N3O2Purity:Min. 95%Molecular weight:347.41 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Formula:C11H16ClNO3Purity:Min. 95%Color and Shape:White to off white solid.Molecular weight:245.7 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molH-Asp-Phe-NH2
CAS:<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>Formula:C13H17N3O4Purity:Min. 95%Molecular weight:279.29 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/mol(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H76N14O12Purity:Min. 95%Molecular weight:993.16 g/molH-His-Ser-OH
CAS:<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br>br>br></p>Formula:C9H14N4O4Purity:Min. 95%Molecular weight:242.23 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/molL-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide
CAS:<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>Formula:C19H31N3O6Purity:Min. 95%Molecular weight:397.47 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molL-Arginine
CAS:<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H14N4O2Color and Shape:White PowderMolecular weight:174.2 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H34N2O7SPurity:Min. 95%Color and Shape:PowderMolecular weight:590.69 g/molH-Glu-Tyr-OH
CAS:<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>Formula:C14H18N2O6Purity:Min. 95%Molecular weight:310.3 g/molH-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH
CAS:<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H164N32O27SPurity:Min. 95%Molecular weight:2,530.86 g/molHSV-1-amide UL 26 Open Reading Frame (242-255)
CAS:<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H117N21O20SPurity:Min. 95%Molecular weight:1,724.98 g/molHCV NS4A Protein (22-34) (H strain)
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H109N17O15SPurity:Min. 95%Molecular weight:1,328.67 g/molBoc-Cys(SEt)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4S2·C12H23NPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:462.71Ac-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/mol(R)-4-N-Boc-2-hydroxymethyl-piperazine
CAS:<p>Please enquire for more information about (R)-4-N-Boc-2-hydroxymethyl-piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3Purity:Min. 95%Molecular weight:216.28 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O7Purity:Min. 95%Molecular weight:518.56 g/molLHRH (7-10)·2 HCl
CAS:<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N8O4·2HClPurity:Min. 95%Molecular weight:513.46 g/molH-Pro-Leu-Gly-NHOH·HCl
CAS:<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N4O4·HClPurity:Min. 95%Molecular weight:336.81 g/molSuc-Ala-Lys-Pro-Phe-pNA
CAS:<p>Suc-Ala-Lys-Pro-Phe-pNA is a casein that has been modified to contain additional lysine residues. This modification increases the protein’s stability, making it more resistant to hydrolysis by phosphatases. Suc-Ala-Lys-Pro-Phe-pNA also contains a peptide sequence that is homologous to a part of the endoplasmic reticulum chaperone FK506 binding protein (FKBP). The peptide sequence in this casein acts as an artificial chaperone and can be used in cell culture experiments to stabilize newly synthesized proteins.</p>Formula:C33H43N7O9Purity:Min. 95%Molecular weight:681.74 g/molH-D-Leu-D-Leu-OH
CAS:<p>H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as it has been shown to affect the transport rate of D-tryptophan and D-alanine. H-D-Leu-D-Leu-OH is a type of molecule that can be found in the human body. It is an amino acid with specificities and transport mechanisms that are not yet well understood. This compound is resistant to aminopeptidase activity and has been shown to have a ph optimum in the intestinal tract. Acetylation of this molecule may also have an effect on its transport rate, as</p>Formula:C12H24N2O3Purity:Min. 95%Molecular weight:244.33 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/molH-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH
CAS:<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N11O21PPurity:Min. 95%Molecular weight:1,118.05 g/molH-Met-His-OH
CAS:<p>H-Met-His-OH is a metabolite of methionine, which has been shown to have insulin sensitizing effects. H-Met-His-OH is produced from the reaction of methionine with hydrochloric acid and water molecule. This compound has been shown to modulate glucose metabolism by increasing insulin sensitivity in diabetic rats. It has also been shown to be able to increase estradiol levels in female mice, which may be due to its ability to inhibit protein synthesis. H-Met-His-OH also binds to histidine residues on the protein surface and may regulate protein kinetics via an unidentate mechanism.</p>Formula:C11H18N4O3SPurity:Min. 95%Molecular weight:286.35 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molH-Leu-Gly-bNA
CAS:<p>H-Leu-Gly-bNA is a chromogenic, dipeptide, which has been shown to react with 2-naphthylamine in the presence of condensation agents and carboxylic acid to form a carboxy group. The amino group on the terminal Leu residue reacts with the carboxy group to form an amide bond. This reaction is used as a method for detecting bNA.</p>Formula:C18H23N3O2Purity:Min. 95%Molecular weight:313.39 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/molH-Gly-Cys-OH
CAS:<p>H-Gly-Cys-OH is an amide that is structurally related to the nonapeptide, Gly-Pro-Cys. H-Gly-Cys-OH has been shown to be an efficient method for preparation of 3-mercaptopropionic acid. The nucleophilic attack of the thiol group on the carbonyl carbon atom in the amide bond leads to cleavage and formation of a disulfide bond. This reaction occurs spontaneously at room temperature with high efficiency and can be used for synthesis of 3-mercaptopropionic acid. H-Gly-Cys-OH has low bioavailability, which may be due to its primary amino group, which is not well absorbed by the intestinal epithelium.</p>Formula:C5H10N2O3SPurity:Min. 95%Molecular weight:178.21 g/mol2-methyl-6-(trifluoromethyl)aniline
CAS:<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>Formula:C8H8F3NPurity:Min. 95%Molecular weight:175.15 g/mol(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/molAnti-Inflammatory Peptide 2
CAS:<p>Anti-inflammatory peptide 2 (AIP2) is a small peptide that has been shown to have anti-inflammatory activity. AIP2 inhibits the production of inflammatory mediators such as prostaglandins and leukotrienes. The synthesis of AIP2 is regulated by a hydroxyl group, which may be important for its therapeutic use. AIP2 does not have any side effects and can be used in the treatment of inflammation. <br>The active form of AIP2 is generated from the amino acid sequence H-His-Asp-Met-Asn-Lys-Val-Leu-Asp-Leu. It has been shown that this sequence also inhibits protein synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. <br>The molecular weight of AIP2 is 706 Da and it has two disulfide bonds and two ester linkages. The metal chelate was found to bind with</p>Formula:C46H77N13O15SPurity:Min. 95%Molecular weight:1,084.25 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/mol(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H60N10O8Purity:Min. 95%Molecular weight:760.92 g/molBoc-Arg(Tos)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-N-methyl-L-valine
CAS:<p>Fmoc-N-methyl-L-valine is a synthetic immunosuppressant that acts by inhibiting the production of cytokines and other inflammatory mediators. It binds to the enzyme cyclooxygenase, which is involved in the synthesis of prostaglandins and thromboxanes. Fmoc-N-methyl-L-valine has been shown to be effective against gram-positive bacteria. This compound also inhibits xanthine oxidase and may act as an analog for azathioprine, which is used in the treatment of autoimmune diseases such as rheumatoid arthritis. The reaction mechanism for this compound is not well understood but appears to involve a nucleophilic attack on a benzoquinoneiminium cation formed from the attack on an electron deficient benzene ring with a triphosgene electrophile.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:353.41 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/mol(Nle 8·21,Tyr34)-pTH (1-34) amide (rat)
CAS:<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H296N56O48Purity:Min. 95%Molecular weight:4,036.65 g/mol(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H312N58O60SPurity:Min. 95%Molecular weight:4,557.07 g/molFmoc-b-Ala-Ala-Pro-OH
CAS:<p>Fmoc-b-Ala-Ala-Pro-OH is a reaction component that can be used in the synthesis of peptides and other compounds. It is a building block for the preparation of complex compounds, such as small molecules, polymers and natural products. Fmoc-b-Ala-Ala-Pro-OH has been shown to be useful in the synthesis of various types of reagents, including antibiotics and pharmaceuticals. This chemical has been reported as a useful scaffold for the preparation of high quality research chemicals. Fmoc-b-Ala-Ala-Pro is also an intermediate in the synthesis of speciality chemicals and fine chemicals.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:479.53 g/molFmoc-Mating Factor a TFA salt
CAS:<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H124N20O19S(freebase)Purity:Min. 95%Molecular weight:1,906.21 g/molH-β-Ala-Val-OH
CAS:<p>H-beta-Ala-Val-OH is a synthetic amino acid that has been positioned in the beta helix of a crystallographic protein. It has a helical structure with an alpha carbon backbone. The dipeptide is water soluble and dipeptides are found in helices, which are hydrogen bonded to other helices. H-beta-Ala-Val-OH also has supramolecular properties, which means it can form structures on its own that are not dependent on other molecules.</p>Formula:C8H16N2O3Purity:Min. 95%Molecular weight:188.22 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molDynorphin A (1-7)
CAS:<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>Formula:C40H61N13O9Purity:Min. 95%Molecular weight:867.99 g/molFA-Ala-OSu
CAS:<p>Please enquire for more information about FA-Ala-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H14N2O6Purity:Min. 95%Molecular weight:306.27 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molH-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H71N11O12S2Purity:Min. 95%Molecular weight:1,166.37 g/molN-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine
CAS:<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>Formula:C13H23NOSiPurity:Min. 95%Color and Shape:Clear Colourless To Pale Yellow LiquidMolecular weight:237.41 g/molNazumamide A
CAS:<p>Nazumamide A is a cyclic peptide with inhibitory activity against serine proteases. It binds to the active site of thrombin and inhibits its action, thereby inhibiting the fibrinogen degradation in blood. Nazumamide A is also found to have neuroprotective properties, which may be due to its ability to inhibit nitric oxide production by binding to the enzyme nitric oxide synthase. It has been shown to have anti-inflammatory activities and can be used for the treatment of inflammation-associated diseases such as asthma and arthritis. Nazumamide A is a nonribosomal peptide that does not require any cofactors for synthesis.</p>Formula:C28H43N7O8Purity:Min. 95%Molecular weight:605.68 g/mol(Pyr 5,N-Me-Phe8, Sar 9)-Substance P (5-11)
CAS:<p>Senktide is a substance P analog that has been shown to produce tail-flick responses in animals. The maximum response of the tail-flick test can be enhanced by the administration of either dopamine or serotonin. Inhibition of metabolism is likely to be responsible for these effects, as demonstrated by experiments in Sprague-Dawley rats. Senktide is an experimental model for studying the role of substance P in the regulation of blood pressure and locomotor activity. This compound also has pressor properties that are similar to those of dopamine and serotonin, which may be due to its ability to stimulate alpha-adrenergic receptors and inhibit dopaminergic neurons via a presynaptic mechanism.</p>Formula:C43H61N9O9SPurity:Min. 95%Molecular weight:880.07 g/molH-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%5-(2-Methyl-4-nitrophenyl)-2-furaldehyde
CAS:<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H9NO4Purity:Min. 95%Molecular weight:231.2 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS:<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Formula:C23H45N7O9Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:563.65 g/molH-Thr-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O5Purity:Min. 95%Molecular weight:233.22 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/molVIP Antagonist
CAS:<p>The VIP antagonist is a model system that has been shown to inhibit the activity of VIP in fetal bovine lung. The VIP antagonist has been shown to be effective against a variety of cancers, including colon cancer and prostate cancer. It also inhibits the production of cytosolic Ca2+ in human skin cells and has anti-inflammatory properties. The VIP antagonist's biological properties have been studied extensively, including its ability to induce neuronal death by inhibiting the release of neurotransmitters from neurons in culture.</p>Formula:C154H257N49O40SPurity:Min. 95%Molecular weight:3,467.06 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Formula:C12H21N3O6SPurity:Min. 95%Molecular weight:335.38 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molBoc-Gly-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molFmoc-Lys(Boc)-Wang resin (200-400 mesh)
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Cholecystokinin Octapeptide (desulfated)
CAS:<p>Please enquire for more information about Boc-Cholecystokinin Octapeptide (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H70N10O15S2Purity:Min. 95%Molecular weight:1,163.32 g/molHIV (gp120) Fragment (318-327)
CAS:<p>Please enquire for more information about HIV (gp120) Fragment (318-327) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H80N16O12Purity:Min. 95%Molecular weight:1,073.25 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purity:Min. 95%Molecular weight:3,253.64 g/molFmoc-Asp-OAll
CAS:<p>Fmoc-Asp-OAll is a cyclic peptide that has been shown to be active against human cancer cell lines in vitro. Fmoc-Asp-OAll binds to integrin receptors, inhibiting the prostaglandin synthesis pathway and thus reducing inflammation. It also inhibits the activity of enzymes that are involved in inflammatory responses. Fmoc-Asp-OAll is synthesized on solid phase by chemical ligation.</p>Formula:C22H21NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:395.41 g/mol(D-Ala2)-Dynorphin A (1-9)
CAS:<p>Please enquire for more information about (D-Ala2)-Dynorphin A (1-9) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H86N18O11Purity:Min. 95%Molecular weight:1,151.36 g/molOsteocalcin (37-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H104N20O19Purity:Min. 95%Molecular weight:1,589.75 g/molPreptin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H268N48O51Purity:Min. 95%Molecular weight:3,932.36 g/molFmoc-Pen (Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pen (Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Angiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Formula:C36H55N11O10Purity:Min. 95%Molecular weight:801.89 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-Leu-Gly-OH
CAS:<p>Z-Leu-Gly-OH is a peptide inhibitor of serine proteases. This peptide is a potential inhibitor of trypanosome proteinases, which are enzymes that cleave proteins into smaller pieces. Z-Leu-Gly-OH is a reversible inhibitor of mammalian proteinase and nitrile protease with a high affinity for the target enzyme.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molH-Glu-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H21N5O5Purity:Min. 95%Molecular weight:303.32 g/mol2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide
CAS:<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>Formula:C12H13NO2SPurity:Min. 95%Molecular weight:235.3 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/molLHRH (free acid) trifluoroacetate salt
CAS:<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>Formula:C55H74N16O14Purity:Min. 95%Molecular weight:1,183.28 g/molGM-CSF (17-31)
CAS:<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H129N27O24Purity:Min. 95%Molecular weight:1,768.97 g/molH-Glu(Glu(Gln-OH)-OH)-OH
CAS:<p>Please enquire for more information about H-Glu(Glu(Gln-OH)-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O9Purity:Min. 95%Molecular weight:404.37 g/molH-Ala-bNA·HBr
CAS:<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>Formula:C13H14N2O·HBrPurity:Min. 95%Molecular weight:295.18 g/molH-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt
CAS:<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40N6O10Purity:Min. 95%Molecular weight:668.69 g/moltrans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate
CAS:<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Arg-Phe-Met-Trp-Met-Arg-NH2
CAS:<p>Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 is a synthetic peptide that binds to the opioid receptors, which are found in many areas of the body, including the brain and peripheral nervous system. Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 has been shown to bind to the mu receptor with an affinity of ˜1 nM. It has also been shown to have antiinflammatory and anticancer properties. Ac-Arg-Phe-Met-Trp-Met -Arg NH2 has also been found in some cases to be effective against neurodegenerative diseases such as Alzheimer's disease. Ac Arg Phe Met Trp Met Arg NH2 is often used as a diluent for peptides and proteins because it does not cause aggregation.</p>Formula:C44H66N14O7S2Purity:Min. 95%Molecular weight:967.22 g/molH-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H107N23O16Purity:Min. 95%Molecular weight:1,418.65 g/molH-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H64N14O11Purity:Min. 95%Molecular weight:844.96 g/mol
