Amino Acids (AA)

<p>Methyl-L-tyrosinate is a drug that has been shown to increase the activity of tyrosinase, an enzyme involved in the production of melanin. It also prevents the oxidation of tyrosine and phenylalanine, which are precursors to melanin. Methyl L-tyrosinate has been studied for its potential effects on hepatitis and Parkinson's disease. This drug binds to the hydroxyl group of tyrosinase and inhibits its activity. The inhibition of this enzyme leads to a decrease in melanin synthesis, which may be beneficial for those with vitiligo or other skin disorders where pigment loss is desired. This drug also prevents oxidative carbonylation and functional assays have shown that it has an affinity for potassium ion coordination chemistry.</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 is a synthetic chemokine that is a member of the CXC subfamily. Chemokines are small proteins that have a hydrophobic region, which allows them to insert into membranes. This chemokine has been shown to be capable of forming dimers in the presence of other chemokines and exhibits a high degree of homology with congener chemokines. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence has been shown to denature at pH 8 and has water solubility; however, it does not dissolve in lipid bilayers such as phospholipid bilayers or monolayers. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence is also stable in an Alzheimer's disease mouse model.</p>

<p>Please enquire for more information about Myelin Basic Protein (87-99) (human, bovine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Glu(OBzl)-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about H-Ser-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Asn-OH is a polyhydroxyamine that is soluble in water and has a low freezing point. It can be used as a coating material, sectioning medium, or to study the thermal expansion of materials. H-Val-Asn-OH has been shown to have no significant effect on the growth rate of bacteria and spores. H-Val-Asn-OH is made up of nitrogen atoms, ferrite, and strain. The microstructure of H-Val-Asn-OH includes a phase equilibrium with ferrite and strain morphology.</p>

<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>

<p>Suc-Ala-Trp-Pro-Phe-pNA is a cyclosporine analog that inhibits the activity of protein isomerases. It has been shown to inhibit the phosphatase activity of casein and stabilize peptide bonds in bovine serum albumin. Suc-Ala-Trp-Pro-Phe-pNA can also be used as a substrate for tyrosine kinase and amide bond formation. Suc-Ala-Trp-Pro-Phe-pNA is an inhibitor of FK506 binding to its receptor, which may be due to its ability to compete with tyrosine residues for binding sites. This compound also exhibits stabilization effects on protein structures by inhibiting the degradation of proteins by proteolytic enzymes or other chemical agents.</p>

<p>Please enquire for more information about Fmoc-Tyr-Ala-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Leech Osmoregulatory Factor H-Ile-Pro-Glu-Pro-Tyr-Val-Trp-Asp-OH (LOF) is a polyunsaturated peptide that regulates osmotic pressure. It has been purified from the leech Hirudo medicinalis and can be used in diagnosis or treatment of eye disorders, such as diabetic neuropathy, or in the treatment of diseases associated with high blood viscosity. LOF binds to the surface of cells and induces changes in cell shape. The binding of LOF to receptors on the cell membrane triggers receptor binding and subsequent activation of ion channels. This leads to an increase in water permeability across the cell membrane and increases the glomerular filtration rate. LOF also binds to monoclonal antibodies that are specific for eye disorders or other conditions associated with high blood viscosity, which may be useful for diagnosis or treatment.</p>

<p>Please enquire for more information about LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>

<p>(Pyr 6,Pro 9)-Substance P (6-11) Pyr-Phe-Phe-Pro-Leu-Met-NH2 is a peptide that has been shown to have locomotor activity in rats, receptor activity, and physiological effects. This peptide binds to the κ opioid receptor and the neurokinin 1 receptor. It was found to have antimicrobial properties against gram positive bacteria and gram negative bacteria. In addition, it has been shown to be an inhibitor of fatty acid synthesis. This molecule also has been studied for its ability to treat metabolic disorders by inhibiting malonic acid production in animals.</p>

<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>

<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>

<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>

<p>Fmoc-Ala-Pro-OH is a peroxide that can be used as a radical initiator for the synthesis of polymers, such as polypropylene. It has been shown to catalyze the oxidation of hydrogen peroxide by a phenoxy group to form radicals. The rate of formation of these radicals is highly dependent on the number and location of proline residues in the molecule. Fmoc-Ala-Pro-OH is chemically stable and does not react with oxygen or light.</p>

<p>The HIV-1 envelope protein, gp120, is a transmembrane glycoprotein that plays a key role in the viral entry process. The gp120 protein contains the binding site for the CD4 receptor and can be cleaved by proteases to remove the membrane-spanning domain. The resulting soluble gp120 (sgp120) is an important co-receptor for HIV infection of target cells such as prostate cancer cells. The sgp120 binds to heparin sulfate proteoglycans on the surface of target cells and triggers cellular activation pathways including angiogenic factors, which induce cell proliferation and migration. This process is important for tumour growth and metastasis, inflammatory bowel disease, and other inflammatory diseases. The sgp120 has also been shown to activate pro-apoptotic proteins such as Bcl-2 family members and Bax. These proteins play a crucial role in apoptosis pathway by regulating mitochondrial membrane integrity, cytochrome c release from mitochond</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thrombospondin-1 (1016-1023) (human, bovine, mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Boc-Tyr1,D-Ala2)-Leu-Enkephalin-Lys Boc-Tyr-D-Ala-Gly-Phe-Leu-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-OH TFA salt is a synthetic peptide that is designed to bind to the nuclear factor kappa B (NFκB) and inhibit its activation. NFκB is a transcription factor that regulates gene expression in response to various stimuli, including proinflammatory cytokines, oxidants, and electrophilic compounds. H-Gly-Arg-Gly-Asp-Ser-OH TFA salt has been shown to inhibit NFκB activation in a model system. This molecule also inhibits axonal growth and pluripotent cells differentiation, which may be due to its suppression of the signal peptide. The rate constant for this drug has been measured using polymer compositions and biocompatible polymers.</p>

<p>Please enquire for more information about Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>Please enquire for more information about Seminal Plasma Inhibin (67-94) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lauroyl-glycine is a fatty acid with a long acyl chain. It is an intermediate in the synthesis of lauric acid, which is used in the production of detergents and soaps. Lauroyl-glycine has been shown to be useful as a model system for skin condition studies due to its detergent properties.</p>

<p>Ac-Leu-Asp-Gln-Trp-Phe-Gly-NH2 is a peptide that was found to inhibit the activity of vasoactive intestinal peptide (VIP). It binds to VIP with high affinity and competitively inhibits its binding to VIP receptors. Ac-Leu-Asp-Gln-Trp-Phe-Gly-NH2 has an inhibitory effect on the maximal response of VIP in tissues, such as the intestine. This peptide also has an irritant effect on the intestine, which may be due to its competitive inhibition of VIP receptor sites. Ac-Leu-Asp-Gln-Trp-Phe Gly NH2 has been shown to have a concentration response curve for inhibiting the activity of Vip.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Asp-Glu-Asp(EDANS)-Glu-Glu-Abu-L-lactoyl-Ser-Lys(DABCYL)-NH2 ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>