Peptides

Peptide Ac-LVLRLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc4-Lys2-Lys-ß-Ala-Wang resin is a resin that is used as an activator for the synthesis of peptides. It has been used in research to study the interactions between proteins, as well as other cell biology and pharmacology studies. The resin is also used to prepare antibodies with high purity. Fmoc4-Lys2-Lys-ß-Ala-Wang resin can be used to purify ligands and receptors, including those that are difficult to purify by conventional methods.

<p>Peptide H-DLLLPQPDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

This synthetic peptide is a hydrophobic RGD Fibronectin Peptide which enhances cell attachment and adhesion. This is due to it containing the Arg-Gly-Asp (RGD) sequence, is a highly conserved integrin recognition sequence within fibronectin. As a result it can promote the adhesion of cells to fibronectin, a protein found in the extracellular matrix and also promotes adhesin of cells to collagen and laminin. One-Letter Formula: Ac-GrGDSPASSKGGGGSrLLLLLLr-Amide

<p>Body Protecting Compound (BPC) 157 is a pentadecapeptide gut peptide with free radical scavenging activity.  As a gastric juice pentadecapeptide fragment, BPC 157 stimulates nitric oxide synthase generation, offering significant gastric cytoprotection. It has been shown to heal lesions in experimental models of bowel disease, Unlike many other peptides, BPC 157 effectively acts without a carrier, notably aiding in muscle healing, such as in the treatment of gastrocnemius muscle complex injuries.  BPC 157 is also an anti-inflammatory agent that has been shown to have clinical relevance in patients with congestive heart failure. BPC 157 has been shown to inhibit inflammation by blocking the production of proinflammatory mediators such as prostaglandins and leukotrienes. It also suppresses the production of proinflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β). BPC 157 also downregulates genes that are involved in liver fibrosis, which may account for its efficacy in patients with liver cirrhosis. BPC 157 increases the production of hepatocyte growth factors (HGFs), which stimulate cell proliferation and promote tissue repair. It also upregulates genes involved in wound healing. Additionally, BPC 157 displays antianxiety and antidepressant effects. At the cellular level, it fosters proliferation, migration, and tube formation in human umbilical vein endothelial cells by activating ERK1/2 phosphorylation.</p>

<p>Peptide H-VTAQELDYLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IPNAGTDPNSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LISWYDNEFGYSNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 is a peptide that has shown to be a potent inhibitor of MMP-1. It may also inhibit other proteases such as collagenase, stromelysin and cathepsins. Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me)-NH2 has a fluorogenic property, which makes it useful for high throughput screening of protease inhibitors. This peptide can be used in the development of new drugs for the treatment and prevention of various diseases such as cancer, cardiovascular disease and arthritis.

Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is a peptide resin that is used in the solid phase synthesis of peptides and small molecules. This product has been shown to be an effective inhibitor for Ion channels, Receptor, Ligand, and even Cell Biology. It is also a high purity reagent that can be used in a variety of applications including Pharmacology and Protein interactions. The Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is available for purchase with CAS No. 680904-06-4.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about SDF-1beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Leu-Gly-Arg-AMC acetate salt is a potential drug target for leishmaniasis. It inhibits the growth of Leishmania by binding to the 17β-estradiol receptor and inhibiting protein synthesis. This drug also has a hydrolytic activity against proteins, which is activated by an acidic environment. It has been shown to inhibit the growth of bacteria including Staphylococcus aureus and Chlamydia pneumoniae by inhibiting urokinase-type plasminogen activator (uPA) and serine protease activities. Boc-Leu-Gly-Arg-AMC acetate salt has also been shown to inhibit cellular proliferation in cancer cells.</p>

<p>Suc-Gly-Pro-Leu-Gly-Pro-AMC (SGLP) is a synthetic substrate that is hydrolyzed by proteases and has been used as a model substrate in protease studies. It has been shown to be cleaved by a number of enzymes, including chymotrypsin, trypsin, elastase, and cathepsin D. The hydrolysis products are sucrose glycolate, glycerol phosphate, leucine amino acid ester, and proline amino acid ester. SGLP has been shown to have low bioavailability in human liver cells and heart tissue. Studies have also shown that SGLP can stimulate the production of myelocytic cells in vitro. This activity may be due to its ability to act as an immunomodulator or by targeting tissue enzyme activities.</p>

IsoDTB (Isotopically labeled Desthoibiotin Azide) probes take advantage of the mass shift of stable heavy isotope labels (SHLs) to enable mass-independent chemical proteomics platform that helps to address unique challenges of the proteome characterization. In this approach a unique isotopic signature is embedded exclusively into the peptides and it serves as a computationally recognizable full-scan MS reporter. By using desthiobiotin, these probes circumvented the need to use cleavable linkers for peptide elution and thus simplifies the chemoproteomic protocol, while allowing quantification of the proteome. IsoTDB pack contains 2 mg of light (IsoDTB-L) and heave (IsoDTB) probe.

H-Pro-Arg-OH acetate salt is a synthetic, antioxidative molecule that has been shown to lower blood pressure in animals. It is also an effective inhibitor of the oxidation of diploid cells and has been shown to be safe for long-term use. H-Pro-Arg-OH acetate salt is used as a structural probe for studies on the binding of fibrinogen to plasminogen. This compound has also been shown to reduce protamine's ability to inhibit fibrinolysis, which may lead to improved blood clotting times.

CLEAR-Acid Resin (100-200 mesh) is a high purity resin that is used for peptide synthesis. It has been used in research as an activator and inhibitor of protein interactions, such as receptor-ligand and antibody-antigen. CLEAR-Acid Resin (100-200 mesh) is often used in antibody production, where it binds to the antigen and activates the immune response against it. CLEAR-Acid Resin (100-200 mesh) has also been used for ion channel research due to its ability to inhibit potassium channels in neuronal cells. The CAS Number for CLEAR-Acid Resin (100-200 mesh) is

<p>H-Trp-Phe-OH is a chromatographic, ligand, and mass spectrometric compound that has a red shift in its fluorescence spectrum. It has been shown to have anti-cancer properties by blocking the cell cycle at the G2/M phase. The red shift of the fluorescence spectrum is due to the presence of two isomeric forms that have different optical properties. H-Trp-Phe-OH has been analysed for its effects on cancer cells and was found to inhibit growth and induce apoptosis in mononuclear leukemia cells.</p>

<p>Peptide H-VVLSQGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WFYIASAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 is a peptide that is involved in tumor targeting. This peptide binds to the integrin αvβ3, which is expressed at high levels on the surface of tumor cells and plays an important role in tumor progression. It has been shown to be able to induce apoptosis in cancer cells and inhibit angiogenesis by binding to the RGD motif on integrins. H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 also inhibits cell proliferation and induces cell cycle arrest.

<p>Fmoc-Phe-Wang Resin is a research tool that is used as an activator, ligand, or receptor for cell biology and protein interactions. It is also used for the synthesis of peptides. Fmoc-Phe-Wang Resin has been used in pharmacology to study ion channels and high purity proteins with high affinity. This resin can be used in antibody production and other life science applications.</p>

<p>Peptide H-RLL^GTEFQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-Asp(OtBu)-2-ClTrt-Resin is a resin that is used for peptide synthesis. It can be used in the synthesis of building blocks, such as thiols, alcohols, amines, and so on. H-Asp(OtBu)-2-ClTrt-Resin can be found in the Tools for Peptide Synthesis category.</p>

Leuprolide is a synthetic hormone that is used for the treatment of prostate cancer. It works by blocking the production of hormones called luteinizing hormone and follicle-stimulating hormone in the body. Leuprolide is also used to treat endometriosis, uterine fibroids, and early puberty. This drug has been shown to have an inhibitory effect on prostate cancer cells in vitro and in vivo.

<p>H-Glu(Met-OH)-OH is an enzyme that catalyzes the conversion of stachyose to sucrose. It is also a synthetase that catalyzes the formation of fatty acids. H-Glu(Met-OH)-OH has been shown to be active in cancer cells and may be used as a potential therapeutic target for cancer treatment. This enzyme is inhibited by sodium hydroxide solution, hydrochloric acid, and urea nitrogen. The activity of H-Glu(Met-OH)-OH is measured by its ability to synthesize fatty acids from glucose in the presence of ATP and NADPH. Hydroxide solution can also be used to measure the activity of H-Glu(Met-OH)-OH as it converts stachyose to sucrose in the presence of ATP, NADP+, and sodium hydroxide solution. The rate at which this reaction occurs can be measured using a spectrophotometer with a carboxylate absorb</p>

<p>Psalmotoxin 1 is a peptide that is an activator of ion channels. It has been shown to bind to the acetylcholine receptor, nicotinic acetylcholine receptor, and the glycine receptor. It also inhibits protein interactions with its high-affinity binding affinity for the alpha-subunit of phospholipase A2.</p>

<p>Oxythiamine chloride hydrochloride is an inhibitor of thiamine-dependent enzymes. It is used in cell factor binding and as a biological control for studies involving the effects of thiamine-dependent reactions. The compound has been shown to inhibit enzyme activities in plants and animal tissues, including those that are involved in energy metabolism. Oxythiamine chloride hydrochloride also has inhibitory properties that may be due to its ability to bind to integrin receptors on the cell surface or to its ability to inhibit DNA synthesis by binding to nuclear DNA.</p>

<p>H-Tyr-Tyr-Tyr-OH is a synthetic compound that has been used to study the mechanism of lactoperoxidase. Lactoperoxidase is an enzyme that catalyzes the oxidation of thiocyanate to form hypothiocyanite, hydrogen peroxide, and a hydroxy group. The hydroxy group is formed by the reaction of two molecules of hydrogen peroxide with a molecule of thiocyanate. This reaction produces an oxygen atom, which then reacts with water to produce an acid. H-Tyr-Tyr-Tyr-OH has been shown to be a substrate for lactoperoxidase in horse serum and bovine serum. It has also been found to react with oxygen at neutral pH levels, forming a product that absorbs ultraviolet light at 280 nm.</p>

For preparation of acids, alcohols, thiols, or amines

Amino acids 40-54 derived from the Immunogenic Myelin Oligodendrocyte protein (MOG). Produced by oligodendrocytes, MOG is an integral part of the oligodendrocyte surface membrane, located in the central nervous system (CNS) and plays an important role in the maintenance and disintegration of the myelin sheath. Unique within their immunoglobulin superfamily, MOG is composed of a transmembrane hydrophobic domain, an extracellular immunoglobulin variable (IgV) domain, a short cytoplasmic loop and within the membrane bilayer there is a second hydrophobic region and after this, a cytoplasmic end. In addition to 218 amino acids of the mature MOG protein, it contains a 29 amino acids long signal peptide. MOG has not only been found to be expressed in the CNS but also at low levels in the peripheral nervous system. Generally MOG is expressed during myelination and functions to maintain the myelin sheath’s structurally integrity through mediating interactions between the myelin and the immune system. This is possible due to its adhesion characteristics and its external location which makes it accessible to antibodies and T-cells. Furthermore is has been suggested that MOG is involved in regulating oligodendrocyte microtubule stability and it can be used as a differentiation marker for oligodendrocyte maturation.Myelin forms a lipid layer around neurons which insulates them. MOG has immunodmainant epitopes: 1-22; 35-55 and 92-106 and this is located at the dimer interface which is formed by MOG IgV domains forming a dimer. These MOG epitopes are recognized by encepalitogenic T cells as foreign antigens. As a result demyelination occurs and this happens in the disease state of Multiple Sclerosis (MS). As MOG is associated with inflammatory demyelinating diseases within the CNS such as neuromyelitis optica spectrum disorders and acute disseminated encephalomyelitis, this MOG (40-54) product can be used to induce these disease states in animals models. One-Letter Formula: YRSPFSRVVHLYRNG

<p>Phytosulfokine (PSK) was introduced in 1996 by Matsubayashi and Sakagami of Nagoya University.  It is the world's first peptide phytohormone to be isolated from asparagus culture medium. Tyr undergoes post-translational sulfation modification, which is essential for bioactivity. As an example of oxidative peptides showing bioactivity, in animals, CCK-octapeptide (26-33) (sulfated form), PCK-4100-V, CCK-33 (Human), PCK-4201-S and CCK-33 (Porcine), PCK-4176-S are known, but they were first found in plants. The functions of phytosulfokine are i) plant cell proliferation and differentiation activity acting at nanomolar concentrations ii) chlorophyll synthesis-promoting activityiii) formation of adventitious roots and buds iv) adventitious embryogenesisv) involvement in disease resistance The active expression of these PSKs is accompanied by membrane-bound LRR receptors, which are PSK receptors. Leucine-rich repeat receptor-like kinase is involved.</p>

Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serum

H-D-Glu(Gly-OH)-OH is a peptide that is used to study the mechanism of glutamate receptors. It has been shown to have an excitatory effect on mouse hippocampal and cerebellar purkinje neurons, with affinity values for membrane channels. It also has been shown to reduce gamma-aminobutyric acid (GABA) levels in the hippocampus and striatum, which may be due to its ability to inhibit glutamic acid decarboxylase. H-D-Glu(Gly-OH)-OH is a potent antagonist of glutamate, binding competitively at the glutamate site on ionotropic receptors. It also inhibits acidic pH and calcium ion concentrations, which are necessary for ionotropic receptor activation.

<p>Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 is a peptide that blocks the melanocortin receptor and inhibits the synthesis of MSH. Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 has been shown to inhibit the growth of cancer cells in culture. It also has antiinflammatory properties and is used for the treatment of skin conditions such as psoriasis and vitiligo.</p>

Des-n-octanoyl-[Ser3]-ghrelin (DOG) is an analog of ghrelin. It has been shown to reduce food intake in rats and humans. DOG reduces the amount of ghrelin that is released from the stomach, which leads to a reduction in appetite. The mechanism by which this occurs is not clear, but it may be related to its effect on neurons in the hypothalamus or other parts of the brain that regulate feeding behavior. DOG also has effects on cells in the pancreas, liver, and adipose tissue that are involved in regulating blood glucose levels and energy metabolism.

<p>Z-Arg-Leu-Arg-Gly-Gly-AMC acetate is a protease inhibitor that blocks the activity of the proteasome. It has been shown to inhibit the activity of histidine proteases and to inhibit proteolysis by the proteasome in a kinetic assay. This inhibitor also inhibits coronavirus replication, which may be due to its ability to bind to histidine residues on proteins involved in viral replication. Z-Arg-Leu-Arg-Gly-Gly-AMC acetate is expressed in transfected cells as an enzyme with a polymerase chain reaction (PCR) product and has been shown to prevent viral replication.</p>

<p>Dpp-iv is a serine protease enzyme that is important for the production of vasoactive peptides and inflammatory mediators. It is involved in the regulation of heart function, blood pressure, and vascular tone. Inhibitors of Dpp-iv have been shown to be useful in the treatment of a variety of diseases including hypertension, coronary artery disease, myocardial infarction, and stroke. Diprotin A is a synthetic inhibitor that has been shown to prevent adenoviral vector-mediated heart damage in neonatal animals. This drug also inhibits the production of vasoactive peptides and inflammatory mediators by blocking Dpp-iv activity, preventing cardiac dysfunction following an infarction.</p>

Peptide H-R^LQSLQTYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YAASSYLSLTPEQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin is a high purity, ion channel ligand that is used in research as a pharmacological tool. It is an activator of Kv1.3 channels and inhibits the function of Kv1.2 channels. This product can be used for the study of protein interactions and receptor pharmacology. Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin also has been found to inhibit the binding of antibodies to cells and can be used for immunoprecipitation experiments. This product has CAS number 188476-46-4 and is available in 1 g and 5 g sizes.

TentaGel; is a gelatinous resin, an important support for solid phase synthesis. TentaGel; resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. These resins are designed for single bead synthesis and single bead analysis (mean particle size 280-320 µm: capacity 02-03 meq/g) Substitutional Functional Group: -O-CH2-CH2-Br.

Fmoc-Lys(Boc)-Wang resin is an acid-labile resin that is used as a solid support for peptide synthesis. It can be cleaved with TFA, HF, and HBr to release the polymeric product.

Peptide Ac-CISQAVHAAHAEINEAGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-K^AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Tyr(tBu)-Rink-Amide MBHA Resin is a solid phase peptide synthesis resin that is used for the production of small scale peptides. This resin has high purity and can be used in the synthesis of proteins, antibodies, and other bioactive molecules. Fmoc-Tyr(tBu)-Rink-Amide MBHA Resin is an ion-exchange resin that can be used to purify peptides by binding to their charged side chains. It is also useful as a research tool for cell biology, receptor pharmacology, and as an inhibitor.

<p>Peptide H-GAEHVNNSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ARGYISTRVEMGEAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

SARS-CoV peptide fragment is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-HAEGTFTSDVSSYLEGQAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDELADSALEIFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LIETYFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LEKPAKYDDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ESTLHLVLRLRGG-hydrazide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Charybdotoxin is a potent and selective ion channel inhibitor. It is a peptide that binds to the receptor site of the potassium channels that are found in nerve cells, blocking their activation. Charybdotoxin has also been shown to inhibit the activity of ligand-gated ion channels, such as acetylcholine receptors. This toxin has been used in research as a tool for studying protein interactions and has also been used in pharmacology as an experimental drug for treating hypertension.</p>

β-Sheet Breaker Peptide iAß5 (Bulk) is a peptide that inhibits the formation of β-sheets in proteins. It has been shown to be an excellent inhibitor of protein interactions, with good selectivity for its target. This peptide also has high purity and can be used as a research tool for studying the function of ion channels and antibodies.

Peptide H-AQLANDVVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NLFLNHSENATAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-NNQIDHIDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HIF-1 alpha (556-574) is derived from hypoxia-inducible factor 1-alpha (HIF-1 alpha), a subunit of the heterodimeric transcription factor HIF-1 and is responsible for maintaining oxygen homeostasis. HIF-1 alpha is expressed under hypoxic conditions and is oxygen sensitive. Hypoxia can occur in cancer, heart disease and pulmonary disorders.Structurally HIF-1 alpha contains a N-terminal transactivation domain (N-TAD) which stabilises HIF-1 alpha and a C-terminal transactivation domain (C-TAD) which under hypoxic conditions regulates the transcription of HIF-1 alpha. Moreover HIF-1 alpha features an oxygen dependent degradation domain containing two proline residues and a lysine532. The two proline residues are substrates of prolyl-4-hydroxylases (PHDs) which in the presence of sufficient oxygen, are hydroxylated. Similarly the lysine residue is acetylated by arrest-defective-1 and this is reduced in hypoxic conditions. These hydroxylated prolines and acetylated lysine target HIF-1 alpha for ubiquitination and degradation.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Biotin-dPEG®11-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Peptide H-VFFGEGDGIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DFTAAFPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLDKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-Arg-Leu-Arg-MCA is a fluorogenic substrate for the proteasome that can be used in proteasome research. Ac-Arg-Leu-Arg-MCA has been shown to be a useful fluorescent substrate for the ubiquitin proteasome system substrates and peptides and biochemicals. It is also an Enzyme Substrate of the Peptides &amp; Biochemicals section.</p>

<p>Peptide H-NLQEINAYIGHSVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CYFQNCPR^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.

<p>Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>

Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-AVLVDLEPGTMDSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pepstatin A is a natural product that has been synthesized for use as an inhibitor of proteolytic enzymes. It inhibits the activity of a wide range of proteases and is used in vitro to study the biochemical properties of these enzymes. Pepstatin A inhibits the activity of many important proteases, including those involved in infectious diseases, such as HIV and hepatitis C virus. Pepstatin A binds to the active site on serine proteases, blocking access by their substrates and thereby inhibiting enzyme activity. The binding site is highly conserved among different types of serine protease, with approximately 90% homology between trypsin and chymotrypsin. The inhibitory mechanism involves a specific interaction between pepstatin A's hydrophobic side chain and the catalytic triad residues His57, Asp102, and Ser195 in trypsin or His57, Asp102, and Ser188 in chymotrypsin.</p>

<p>Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSGFGNFDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-HVPGGGSVQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>