Peptidi

Peptide H-L^TVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The blood-brain barrier (BBB) is a major obstacle to drug delivery into the central nervous system (CNS), in particular for macromolecules such as peptides and proteins. However, certain macromolecules can reach the CNS via a receptor-mediated transcytosis (RMT) pathway, and low-density lipoprotein receptor-related protein 1 (LRP1) is one of the promising receptors for RMT. L57 can therefore be used for the development of RMT-based drugs for the treatment of CNS diseases.

Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IPIEDGSGEVVLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TTPPV^LDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TTPPV^LDSDGSYFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-QKRAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SFEMLIL^GR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TLHEYMLDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-EYLFEVDNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SANYETDPFVQEFQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TNLESILSYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ETEVIDPQDLLEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GLEWV^AEI^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ADLSGITGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TAFDEAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LVLPEYGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide pE-HWSY^GL^RP^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TWNDPSVQQDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GATQQILDEAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-ELESPPPPYSRYPMD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TNYLTHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-NNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Rhod-HIPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AQLGDLPWQVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-CSSNTPPLTCQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-A^LPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-DWEYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IGQLEEQLEQEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NEQEQPL^GQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IIWDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons- astrocytes- microglia- epithelial cells- endothelial cells- immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.

Galanin (1-30) (human) is an endogenous neuropeptide with endocrine, metabolic and behavioural effects. Galanin has a role in intestinal smooth muscle contraction, insulin and somatostatin release, and synaptic neurotransmission.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.Galanin protects against various physiological insults in vitro, including excitotoxicity and β-amyloid toxicity. Changes in galanin have been widely studied in Alzheimer's disease, and galaninergic neurons are spared in late-stage Alzheimer's relative to non-galaninergic neurones.Galanin (1-30) has been used as an agonist for the GalR2 receptor in vitro for calcium mobilisation assays to understand the role Galanin/GalR2 play in multiple sclerosis.Galanin (1-30) is provided with an N-terminal borondipyrromethene (BDP) fluorophore (630/650), excitation/ emission 628/642nm. It offers a relatively long fluorescence time and high quantum yield as a fluorophore. BDP630/650 is highly suited to in vivo cell imaging, co-localisation imaging and dynamic organelle fusion. Galanin (1-30) is provided with an N-terminal cysteine residue that allows site-specific conjugation.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LSELIQPLPLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-L^^GTL^^DNPSSL^^DETAYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QDGNEEM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FNWYVDGVEVHNAKTKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EFTPPVQAAYQK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Lys-Lys-Lys-Asp-Lys-Val-Lys-Lys-Gly-Gly-Pro-Gly-Ser-Glu-Cys-Ala-Glu-Trp-Ala-Trp-Gly-Pro-Cys-Thr-Pro-Ser-Ser-Lys-Asp-Cys-Gly-Val-Gly-Phe-Arg-Glu-Gly-Thr-Cys-Gly-Ala-Gln-Thr-Gln-Arg-Ile-Arg-Cys-Arg-Val-Pro-Cys-Asn-Trp-Lys-Lys-Glu-Phe-Gly-Ala-Asp-Cys-Lys-Tyr-Lys-Phe-Glu-Asn-Trp-Gly-Ala-Cys-Asp-Gly-Gly-Thr-Gly-Thr-Lys-Val-Arg-Gln-Gly-Thr-Leu-Lys-Lys-Ala-Arg-Tyr-Asn-Ala-Gln-Cys-Gln-Glu-Thr-Ile-Arg-Val-Thr-Lys-Pro-Cys-Thr-Pro-Lys-Thr-Lys-Ala-Lys-Ala-Lys-Ala-Lys-Lys-Gly-Lys-Gly-Lys-Asp (Disulfide bonds between Cys15-Cys39, Cys23-Cys48, Cys30-Cys52, Cys62-Cys94, and Cys72-Cys104)

Peptide LCBiot-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VL^AVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-LPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLETEILESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLADEFIIPGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTMLISGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EAEAAMFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DSSEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-KKARFSRFAGSSPSQSSMVAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LSTIALALGVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Biot-SHLVEALYLVCGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FTPPQPAEPWSFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DSYVGDEAQSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Biot-Ahx-RRRVTSPARRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DTGILDSLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ARTKQTARC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LLVVTDPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide DOTA-CPRECESIC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ADGGAEYATYQTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide 5TAMRA-R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide JasmonicAcid-I^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

PUMA (p53 upregulated modulator of apoptosis) is a potent pro-apoptotic protein that plays a critical role in stress-induced cell death. It is primarily activated by the tumor suppressor p53 in response to DNA damage, but can also be triggered by other factors in response to various cellular stresses. PUMA functions by disrupting the balance of Bcl-2 family proteins, leading to mitochondrial dysfunction and caspase activation. Due to its involvement in various diseases, PUMA is considered a potential therapeutic target for both cancer and neurodegenerative diseases.

Peptide H-ATFNPAQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YASESMSGI^P^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ILGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VGLPISQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TVESITDIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YYNNDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FEQNTAQP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YRFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Biot-SARAGETRFTDTRKDE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-FHENWPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-QEAFSHIRIPLPH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

E-64-d is a research tool that is used in cell biology, pharmacology, and biochemistry to study protein interactions. E-64-d is an activator, ligand, or receptor for ion channels and has been shown to inhibit the activity of high purity K+ channels. This peptide binds to the extracellular loop of voltage-gated potassium channels (Kv1.2) and inhibits the opening of these channels by blocking their access to ATP. E-64-d also binds to an antibody as a competitive inhibitor of the antigen binding site on the antibody.

Eptifibatide is a drug that is used in the treatment of congestive heart failure, acute coronary syndrome and peripheral artery disease. It is a glycoprotein IIb/IIIa inhibitor that binds to integrin receptors on platelets and prevents them from binding to fibrinogen. This prevents blood clotting and reduces the risk of stroke or heart attack. Eptifibatide has been shown to be effective for the treatment of bowel disease, infectious diseases, and experimental models of myocardial infarcts. The drug has significant cytotoxicity, which may be due to its ability to inhibit cell proliferation by blocking protein synthesis at the ribosome level.
Eptifibatide has been shown to have a disulfide bond between two cysteine residues located in its amino-terminal region. This bond stabilizes the molecule in solution and ensures that it remains active until it reaches its target site.

MCA conjugated molecule targeting furin

Dap3-Ghrelin is a Ghrelin related peptide and is the active fragment of Ghrelin that binds to Ghrelin receptors with high affinity and activates the same signaling pathway as endogenous ghrelin. This product can be used in the study of obesity as Ghrelin has been shown to be a hormone that stimulates appetite and meal initiation. It could also play a role in gaining a further understanding into diabetes as Ghrelin has been found to stimulate insulin release.

Boc-Glu(OBzl)-OH is a peptide that inhibits the enzyme adenylate kinase. It binds to the ATP binding site on the enzyme and blocks access of the substrate, ADP, to its catalytic site. This prevents ATP from being converted into AMP, which is needed for cellular energy production. Boc-Glu(OBzl)-OH has been used in research as an inhibitor in cell biology and pharmacology studies.
The purified product is supplied at high purity with low endotoxin levels.

Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.

Fmoc-Arg(Pbf)-OH is an amido-resin that is used in the industrial preparation of polyamides and as a reactive component for the synthesis of various peptide or protein drugs. The polymerisation reaction leads to the formation of a linear chain with a high molecular weight and low viscosity. Fmoc-Arg(Pbf)-OH has been used as an envisaged component for the synthesis of acetylcholine, messenger RNA, and nicotinic acetylcholine receptor. Trifluoroacetic acid is commonly used as a solvent in this process.

Peptide H-YLIPNATQPESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DFDFVPPVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Proangiotensin-12 is a peptide that is used as a research tool for the study of angiotensin II and its receptor. This product is an activator of the receptor and can be used to identify antibodies against the protein. Proangiotensin-12 has been shown to inhibit ion channels, and has also been shown to bind with high affinity to the angiotensin II receptor. This product can be used in pharmacological studies on ligands or receptors.

Boc-Thr(Bzl)-OH is a peptide that can be used as an activator, inhibitor and ligand. It has been shown to activate ion channels and increase the permeability of cell membranes. The high purity of this peptide allows it to be used in research tools such as antibody production, protein interactions, and receptor ligand pharmacology.

Fmoc-D-Arg(Pbf)-OH is a synthetic D-arginine peptide. It is an inhibitor of protein interactions, activator of ligand, and a research tool for receptor binding studies. Fmoc-D-Arg(Pbf)-OH has been used to characterize ion channels and antibody binding sites. This molecule has high purity with no impurities or traces of solvent.

Bz-Gly-Arg is a basic protein that belongs to the class of peptide hormones. It is activated by hydrolysis and has been shown to be highly active in human serum. Bz-Gly-Arg inhibits creatine kinase, which is an enzyme that breaks down ATP and creatine phosphate to produce creatinine and ADP. This inhibition leads to a decrease in ATP levels, which can lead to cell death. The kinetic properties of Bz-Gly-Arg have been studied using sephadex G-100 chromatography and found the optimum pH for this protein is neutral. The polymerase chain reaction has also been used to study the sequence of amino acids in this protein, showing it contains amide bonds as well as peptides and biochemicals.>>END>>

Peptide H-HSQPWQVLVASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

NPY is a peptide that belongs to the family of neuropeptides. NPY regulates appetite and energy expenditure, among other physiological processes, by binding to receptors in the brain. NPY has been shown to be an inhibitor of protein interactions, activator of ligands, and a receptor for antibodies. This peptide is synthesized in the hypothalamus as well as other parts of the central nervous system. NPY is also found in blood platelets, pancreas, and intestines.

Peptide Ac-SVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.

Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.

H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.

Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.

Peptide Ac-KKRYDREFLLGFQF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.

Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.

Boc-D-Lys(Cl-Z)-OH is a synthetic peptide that has been shown to bind to the activator region of the human epidermal growth factor receptor (EGFR). It has also been shown to inhibit ion channels and activate ligand-gated ion channels. This product is a research tool for use in cell biology, pharmacology, and other life science research. Boc-D-Lys(Cl-Z)-OH can be used as an antibody or ligand for a receptor, as well as an inhibitor for protein interactions.

TCTU Reagent is a coupling reagent that is used to synthesize peptides. TCTU Reagent is a building block for peptide synthesis, which can be used to produce peptides of different lengths. TCTU Reagent also has the ability to condense two amino acids together in sequence to form a dipeptide. This reagent has been shown to be compatible with most amino acids, except glycine and tryptophan, and can be used for both automated or manual peptide syntheses.

Gly-Pro is a cyclic peptide that binds to DPP-IV and inhibits proteolytic activity. It has been shown to have inhibitory properties against infectious diseases and cancer tissues, as well as a fluorescence probe for the detection of DPP-IV. Gly-Pro is also a potential inhibitor of neuronal death and has been shown to have structural analysis in the form of molecular docking analysis.

Peptide H-SILLTEQALAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Tyr-Val-Ala-Asp-H (aldehyde) is a peptide that inhibits the activity of protein tyrosine phosphatases, which are enzymes that remove phosphate groups from proteins. This agent binds to the amino acid side chains of an enzyme and prevents it from binding to its substrate. Ac-Tyr-Val-Ala-Asp-H (aldehyde) is a research tool that can be used in life sciences as an inhibitor or activator for peptides, receptors, and ion channels. Ac-Tyr-Val-Ala-Asp-H (aldehyde) has been shown to be active in the inhibition of protein tyrosine phosphatase 1B and 2A isoforms.

Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.
The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.
The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials.

Boc-Leu-OH • 2O is a monomer for the synthesis of peptides. It is hydrophobic and can be used as a polymer matrix for the synthesis of polypeptides. Boc-Leu-OH • 2O is obtained from nature and can be prepared by hydrolysis of chloroformate ester or hydrogen chloride in dioxane.
Boc-Leu-OH • 2O has been shown to have chiral properties and can be detected using microscopy, dichroism, or amino acid analysis.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Boc-Glu(OcHex)-OH is a peptide inhibitor that is used in research to study the effects of protein interactions. Boc-Glu(OcHex)-OH binds specifically to the receptor and blocks ligand binding, preventing activation. This drug is an ion channel activator and an antibody against this drug has been developed. Boc-Glu(OcHex)-OH is soluble in water at ambient temperatures and has a purity of 99%.

BOP Reagent is a reagent that reacts with the phosphate group of dinucleotide phosphates, such as those found in DNA and RNA. It can be used for structural analysis and to determine the presence of nucleic acids in human serum or other biological samples. The BOP Reagent binds to the phosphate group by means of intramolecular hydrogen bonding. This reaction generates a transient, covalently-bound enzyme-substrate complex that can be detected by fluorescence probe.

Fmoc-Gln(Trt)-OH is a synthetic, acid-stable, antimicrobial peptide that can be used as an analytical reagent. It has been shown to inhibit the growth of mammalian cells and bacterial cells in vitro by binding to nicotinic acetylcholine receptors. Fmoc-Gln(Trt)-OH contains sequences that are found in microbial proteins, suggesting that it may have antimicrobial activity against bacteria. The chemical diversity within this molecule may also contribute to its antimicrobial activity.

Boc-His(Tos)-OH is an activating reagent for solid-phase peptide synthesis. It can be used as a building block for the synthesis of peptide chains on a solid support. Boc-His(Tos)-OH is typically used in conjunction with other reagents, such as Fmoc-amino acids and DCC, to synthesize amino acid sequences on the surface of the resin. This reagent is often used in high-throughput peptide synthesis protocols.

PyBOP is an acyclic nucleoside phosphonate that is structurally similar to cyclic peptides and coumarin derivatives. It has been shown to be active against infectious diseases such as malaria and hepatitis C, as well as metabolic disorders such as obesity. PyBOP also has a number of physiological effects, including thermal expansion and immunomodulation. PyBOP binds to the 3'-hydroxyl group of RNA by hydrogen bonding interactions in vivo and inhibits rRNA synthesis, leading to the inhibition of protein synthesis. This drug also disrupts the disulfide bond between cysteine residues in proteins, which may lead to autoimmune diseases. PyBOP is water-soluble and highly soluble in organic solvents, but not soluble in water or polar solvents such as DMSO or acetone. br>br> The thermal expansion coefficient for PyBOP is about 10^6 K^-1mol^

Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Dap(Dnp)-NH2 is a synthetic peptide that binds to the toll receptor. The binding of this peptide leads to the signal pathways, which are responsible for the body formation. Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser Arg Dap (Dnp) -NH2 has been shown to have an antiinflammatory effect in rats. This peptide also has a dna binding activity and can be used as a marker for granule neurons in the brain.

BNP-32 is a peptide that has been shown to activate G-protein coupled receptors and ion channels. It is known to be an agonist of the receptor for bradykinin and vasoactive intestinal peptide, as well as the receptor for neurotensin, which is a member of the tachykinin family. BNP-32 can also inhibit ligand binding to some receptors, such as those for calcitonin gene-related peptide (CGRP) and substance P (SP). BNP-32 has been used as a research tool in cell biology and pharmacology.

The outer membrane of gram-negative bacteria contains lipopolysaccharides (LPS) composed of lipid A. Lipid A is produced from the tetra-acylated precursor molecule, lipid IVA. As a part of a host's innate immune response there are toll-like receptor 4 (TLR4) and MD-2 which are expressed on immune cells. TLR4 and MD-2 recognize LPS leading to the activation of NFκB and pro-inflammatory cytokine production. Studies have suggested lipid A in Escherichia coli to be an agonist for both mouse and human TLR4, while lipid IVA can induce species specific TLR4 responses. For example for horse and mouse TLR4 and MD-2, Lipid IVA is an agonist where as it is an antagonist for TLR4 and MD-2 in humans.

Omega-conotoxin MVIIA is a peptide that is an activator of voltage-gated calcium channels. It is an inhibitor of the L-type calcium channel and can be used to study protein interactions in cell biology. Omega-conotoxin MVIIA has been shown to have binding affinity for the nicotinic acetylcholine receptor, which belongs to the class of ligand-gated ion channels. This toxin has also been used as a research tool in pharmacology and antibody production. Omega-conotoxin MVIIA has a molecular weight of 3,411 daltons, with purity greater than 95%. CAS No. 107452-89-1

Abz-Gly-Phe(NO2)-Pro-OH is a peptide that has been shown to have antihypertensive activity. It also has radical scavenging properties, and it can be used as an amino acid composition marker. Abz-Gly-Phe(NO2)-Pro-OH has been shown to inhibit the growth of faecalis and subtilis, which are both Gram positive bacteria. The peptide has also been shown to have inhibitory properties against proteolytic enzymes from bovine casein, human serum and rat blood pressure.

Boc-Pro-OH is a synthetic amino acid that is used in the preparation of samples for gas chromatography. Boc-Pro-OH has antiinflammatory activity, and can be used to treat cancer. It is also used as an intermediate in the synthesis of amides, which are important in pharmaceuticals. Boc-Pro-OH is soluble in water and carbonate buffer solutions, but insoluble in ethanol. The chemical structure of this molecule is unusual because it contains a Boc group.

Siastatin B is a peptide that can be used as a research tool for studying protein interactions. It has been shown to be an activator of ligand-gated ion channels, such as nicotinic acetylcholine receptors and glutamate receptors. Siastatin B also binds to the neurotoxin receptor, which leads to the inhibition of the binding of neurotoxins to this receptor. The inhibitory activity of siastatin B is reversible and competitive with respect to the neurotoxin receptor. Siastatin B also inhibits cell proliferation at high concentrations.

PAMP-12 is a peptide that can activate the human immune system. It can be used as a research tool for studying protein interactions and receptor ligand pharmacology. PAMP-12 is an inhibitor of ion channels, which are proteins that regulate the flow of ions through cell membranes. The CAS number for this peptide is 196305-05-2.

Boc-γ-Abu-OH is a model drug used in peptide synthesis. It is a building block that can be used to form the amino acid γ-Abu. This amino acid has an unusual β-amino group, which is coupled with the Boc group using photorelease chemistry. The resulting compound can be used as a building block for dendrimer or convergent syntheses.
Boc-γ-Abu-OH reacts with dimethoxybenzene and dendron to form γ-Abu. The resulting product can be reacted with other molecules, such as diamines and benzyl halides, to produce analogues of γ-Abu. This process allows for the synthesis of new compounds that have not been previously reported in the literature.

Fmoc-γ-Abu-OH is a fatty acid that belongs to the group of neurotrophic factors. It has been shown to have neuroprotective properties in vitro and in vivo, and its mechanism may be related to its inhibition of apoptotic cell death. Fmoc-γ-Abu-OH also has pharmacokinetic properties, which are dependent on the route of administration. This compound is absorbed through the gastrointestinal tract and distributed throughout the body with a half-life of approximately 12 hours. Fmoc-γ-Abu-OH binds to β-catenin and inhibits its degradation by proteasomes, thereby increasing its levels in cells.

Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure. Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial.

ß-Endorphin, also known as Equine ß-Endorphin, is a polypeptide hormone that is a member of the endorphin family. It is a peptide consisting of nine amino acids. ß-Endorphin has been found in the pituitary gland and in other tissues in concentrations much higher than those of other endorphins. Beta-endorphin is thought to be involved in pain relief and stress relief.

Peptide H-VLIVPQNFVVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CA-074 is a research tool that can be used to study protein interactions. CA-074 is a small, synthetic peptide and a potent inhibitor of the ion channel TRPC1. It has been shown to inhibit the calcium currents in HEK293 cells expressing TRPC1 channels. CA-074 inhibits the kinase activity of PLCγ2, which leads to reduced phosphoinositide levels and a decrease in cell proliferation. CA-074 also inhibits PKCδ and PKCε, which are members of the protein kinase C family.
The inhibition of these enzymes by CA-074 causes an increase in the intracellular concentration of diacylglycerol (DAG) and inositol triphosphate (IP3). These two molecules are involved in G protein signaling pathways that regulate cell proliferation, differentiation, and survival.

Fmoc-Pro-OH is a peptide that contains the Fmoc protecting group. It is used in the synthesis of peptides and has been shown to be effective against microbial infections with marine sponges. The synthesis of this compound can be carried out on an on-line automated peptide synthesizer. The Fmoc protecting group is removed by treatment with trifluoroacetic acid (TFA) in dichloromethane, which leaves the side chain unprotected. This compound has a high binding affinity for the receptor site of fibrinogen and can potentially inhibit the growth of bacteria that cause bacterial infection, such as Staphylococcus aureus and Pseudomonas aeruginosa.
Fmoc-Pro-OH can also be used to synthesize other functional groups such as sulfamoyl groups or acetonitrile groups, depending on the desired outcome.

Boc-D-Trp-OH is a trisubstituted, enantiomerically pure, excitatory amino acid. It has been shown to stimulate the release of neurotransmitters in the central nervous system and to have potent antitumor activity. Boc-D-Trp-OH is an unsaturated ketone that can be used as a building block for peptide synthesis. The disulfide bond present in this molecule may be reduced by the addition of DTT or DTE. This compound has also been shown to have cardiac hypertrophy inhibiting effects, due to its ability to inhibit PDE5 enzyme activity.

Enkephalins are a group of endogenous peptides that are the most potent natural analgesic and have been shown to relieve pain by inhibiting neurotransmitters. The (Met(O)5)-enkephalin analog is a structural analog of the enkephalin peptide with a sulfoxide linkage at position 5. This analog has been shown to inhibit acetylcholine release from intestinal ganglia, which may be related to its effects on postsynaptic potentials and glutamate release. This compound also absorbs in the small intestine, where it is taken into the blood stream and transported to the brain. The (Met(O)5)-enkephalin analog has been shown to reduce pain in Sprague-Dawley rats, as well as inhibit intestinal transit time and stimulate intestinal motility.

Amastatin is a synthetic product that inhibits peptidases. It is an inhibitor of the protease enzyme and can be used in the treatment of bladder infections caused by Chlamydia parvum. Amastatin has also been shown to inhibit Aminopeptidase, which is an enzyme that cleaves amino acids from proteins, thereby inhibiting protein synthesis. Amastatin has been shown to have an inhibitory effect on proteases in the striatal membranes of rats and may be useful in treating neurodegenerative disorders such as Parkinson's disease.

Boc-p-Aminobenzoic Acid is an extracellular peptidase inhibitor that has been shown to be damaging to cells. It is a conjugate of p-aminobenzoic acid with the unusual amino acid Boc, which inhibits the activity of proteinases and peptidases. This drug is used for the treatment of emphysema, an autoimmune disease, and prostate carcinoma. It has also been shown to inhibit the growth of some tumor cells by blocking cell division and DNA synthesis. The enzyme carbonic anhydrase II (CAII) is responsible for the conversion of carbon dioxide into bicarbonate ions in tissues. Boc-p-Aminobenzoic Acid can inhibit CAII, which may lead to tissue damage or death.

Z-Val-Lys-Met-MCA is a synthetic peptide that can act as an inhibitor or activator. Z-Val-Lys-Met-MCA binds to the receptor and inhibits the receptor from binding with its ligand, which prevents activation of the receptor. It also has been shown to activate other receptors, such as ion channels, by binding to them. This makes it an important research tool for understanding protein interactions.

Peptide H-GA^IIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LQDAGVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LAQAYYESTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-G^PSIFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SVETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-HSNSLGPIFDHEDLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LGPALATGNVVVMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide 5Fam-NTKNHPMLMNLLKDNPAQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LNEVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-CVTGYRLFEEIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SSPAVEQQLLVSGPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTLTPEEEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-NALWHTGNTPGQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-S^LSLSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VGDYGSLSGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.