One of the most relevant brands among our more than 25 partners is TargetMol
We have reached an agreement with TargetMol: CymitQuimica clients will benefit for a 20% discount on all TargetMol products until the end of the year.On our website you can find the products offered by this partner, which has become one of the world's most recognised compound libraries and small molecule inhibitors supplier. TargetMol offers approximately 120 compound libraries and a wide range of chemical products and kits for life sciences.
Ends on Dec 31( 8 days left )
Substance P
CAS:Substance P (Neurokinin P) (SP) is an undecapeptide (a peptide composed of a chain of 11 amino acid residues) member of the tachykinin neuropeptide family.Formula:C63H98N18O13SPurity:98% - 99.51%Color and Shape:White PowderMolecular weight:1347.63Substance P acetate
Substance P acetate is a peptide mainly secreted by neurons and is involved in many biological processes including nociception and inflammation.Formula:C65H102N18O15SPurity:98.81%Color and Shape:SolidMolecular weight:1407.68N-Acetylcarnosine
CAS:N-Acetylcarnosine (N-Acetyl-L-carnosine) is thought to be able to combat some of the effects of oxidative stress as it has anti-oxidant properties.Formula:C11H16N4O4Purity:99.69% - >99.99%Color and Shape:SolidMolecular weight:268.27N-Acetylcarnosine acetate
<p>N-Acetylcarnosine acetate, a dipeptide, yields L-carnosine and treats human cataracts.</p>Formula:C13H20N4O6Purity:98%Color and Shape:SolidMolecular weight:328.32SPR741 TFA (1179330-52-9 free base)
<p>SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.</p>Formula:C46H74F3N13O15Purity:98%Color and Shape:SolidMolecular weight:1106.15SPR741
CAS:SPR741, a cationic peptide from polymyxin B, is being developed to treat serious Gram-negative infections.Formula:C44H73N13O13Purity:98%Color and Shape:SolidMolecular weight:992.13MOG (35-55) TFA
<p>MOG (35-55) TFA is a minor component of central nervous system myelin with encephalitogenic activity</p>Formula:C120H178F3N35O31SPurity:98%Color and Shape:SolidMolecular weight:2695.97Myelin Basic Protein (MBP) (68-82), guinea pig
CAS:<p>Myelin Basic Protein (MBP) (68-82) is a fragment of myelin basic protein (MBP) with the sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn.</p>Formula:C71H113N23O28Purity:>99.99%Color and Shape:SolidMolecular weight:1736.79TAK-448 acetate
CAS:TAK-448 acetate (MVT-602 acetate) is a KISS1R agonist, a synthetic peptide similar to kisspeptin.Formula:C60H84N16O16Purity:99.88%Color and Shape:SolidMolecular weight:1285.41Melanotan I
CAS:Melanotan I is a non-specific melanocortin receptor (MCR) agonist, an α-melanocyte-stimulating hormone (α-MSH) analog, which is injected subcutaneously toFormula:C78H111N21O19Purity:>99.99%Color and Shape:SolidMolecular weight:1646.85Motilin, canine
CAS:<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formula:C120H194N36O34Purity:98%Color and Shape:SolidMolecular weight:2685.05M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formula:C70H91N15O27Purity:98%Color and Shape:SolidMolecular weight:1574.56[bAla8]-Neurokinin A(4-10)
CAS:[bAla8]-Neurokinin A(4-10) is a neurokinin 2 (NK2) receptor agonist.Formula:C35H56N8O10SPurity:98%Color and Shape:SolidMolecular weight:780.94Nonapeptide-1 acetate salt (158563-45-2 free base)
<p>Nonapeptide-1 acetate salt (158563-45-2 free base) (Melanostatine-5 acetate salt) , a peptide hormone, is a potent α-Melanocyte-stimulating hormone (α-MSH)</p>Formula:C63H91N15O11SPurity:98.26%Color and Shape:SolidMolecular weight:1266.58MCH (salmon) TFA (87218-84-6 free base)
MCH, a 19 amino acid peptide in the hypothalamus, regulates arousal, behavior, and food intake in mammals.Formula:C91H140F3N27O26S4Purity:98%Color and Shape:SolidMolecular weight:2213.5Cotadutide acetate
Cotadutide acetate is a potent GLP-1 and glucagon receptor dual agonist with EC50s of 6.9 pM and 10.2 pM.Formula:C169H256N42O57Purity:98.28%Color and Shape:SolidMolecular weight:3788.14Melanin Concentrating Hormone, salmon
CAS:Melanin Concentrating Hormone (MCH), a 19 amino acid cyclic peptide, is largely expressed in the hypothalamus.Formula:C89H139N27O24S4Purity:98%Color and Shape:White PowderMolecular weight:2099.48Melanin Concentrating Hormone, salmon acetate
Melanin Concentrating Hormone, salmon acetate (MCH (salmon)) is a 19 amino acid cyclic peptide, is largely expressed in the hypothalamus.Formula:C91H143N27O26S4Purity:99.41%Color and Shape:SolidMolecular weight:2157α-Factor Mating Pheromone, yeast (TFA)
The alpha factor pheromone arrests yeast in the G1 phase of their cell cycle.Formula:C84H115N20F3O19SPurity:98%Color and Shape:SolidMolecular weight:1798.02α-Factor Mating Pheromone, yeast
CAS:<p>Alpha factor mating pheromone is a peptide of 13 amino acids secreted by Saccharomyces cerevisiae α cells.</p>Formula:C82H114N20O17SPurity:98%Color and Shape:White PowderMolecular weight:1684α-Factor Mating Pheromone, yeast acetate
<p>α-Factor Mating Pheromone, yeast acetate (Mating Factor α acetate) is a peptide of 13 amino acids secreted by Saccharomyces cerevisiae α cells.</p>Formula:C84H118N20O19SPurity:96.85%Color and Shape:SolidMolecular weight:1744.05Mas7
CAS:<p>Amphiphilic peptide Mas7, a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its downstream effectors.</p>Formula:C67H124N18O15Purity:98%Color and Shape:SolidMolecular weight:1421.81Mas7 acetate(145854-59-7 free base)
<p>Mas7 acetate(145854-59-7 free base) (Mastoparan 7 acetate) , a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its</p>Formula:C69H128N18O17Purity:99.77%Color and Shape:SolidMolecular weight:1481.86Allergen Gal d 4 (46-61), chicken
CAS:Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.Formula:C72H116N22O29Purity:98%Color and Shape:SolidMolecular weight:1753.82Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Formula:C225H349N48O68ClPurity:98%Color and Shape:SolidMolecular weight:4849.91Tirzepatide
CAS:Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.Formula:C225H348N48O68Purity:99.52% - 99.99%Color and Shape:SolidMolecular weight:4813.45Tirzepatide Acetate(2023788-19-2 free base)
Tirzepatide (LY3298176) Acetate (2023788-19-2 free base) is a new molecule that can control blood glucose levels.Cost-effective and quality-assured.Formula:C227H352N48O70Purity:97.3% - 98.05%Color and Shape:SolidMolecular weight:4873.5Tirzepatide monosodium salt
Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.Formula:C225H347N48O68NaPurity:99.69%Color and Shape:SoildMolecular weight:4835.51Luteinizing Hormone Releasing Hormone (LH-RH), salmon
CAS:LH-RH: a hypothalamus-made pituitary hormone, key in reproductive control.Formula:C60H73N15O13Purity:98%Color and Shape:SolidMolecular weight:1212.31LH-RH, salmon acetate(86073-88-3 free base)
<p>LH-RH salmon acetate (86073-88-3) is a hypothalamic hormone controlling reproduction.</p>Formula:C62H77N15O15Purity:99.83%Color and Shape:SolidMolecular weight:1272.35[Leu5]-Enkephalin, amide acetate
<p>[Leu5]-Enkephalin, amide acetate is a δ opioid receptor agonist.</p>Formula:C30H42N6O8Purity:99.36%Color and Shape:SolidMolecular weight:614.69Leucokinin VIII
Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach.Formula:C42H52N10O11Purity:98%Color and Shape:SolidMolecular weight:872.92Leucokinin VIII acetate
<p>Leucokinin VIII acetate (Leucokinin 8) is an diuretic octapeptide isolated form head extracts of the cockroach.</p>Formula:C44H56N10O13Purity:98.52%Color and Shape:SolidMolecular weight:932.99L-Asparaginase
CAS:<p>L-Asparaginase, an enzyme for acute lymphoblastic leukemia treatment, is administered via injection.</p>Formula:NAPurity:97%Color and Shape:SolidMolecular weight:N/AKinetensin
CAS:Kinetensin is a neurotensin-like peptide.Formula:C56H85N17O11Purity:98%Color and Shape:White Lyophilised SolidMolecular weight:1172.38Kinetensin acetate(103131-69-7 free base)
<p>Kinetensin acetate(103131-69-7 free base) is isolated from pepsin-treated human plasma. Kinetensin acetate(103131-69-7 free base) is a neurotensin-like peptide.</p>Formula:C58H89N17O13Purity:>99.99%Color and Shape:SolidMolecular weight:1232.45IFN-α Receptor Recognition Peptide 1
CAS:<p>IFN-α Receptor Recognition Peptide 1, associated with receptor interactions, is a peptide of IFN-α.</p>Formula:C35H59N13O12SPurity:98%Color and Shape:SolidMolecular weight:885.99IRBP(668-687) (TFA) (1977546-93-2 free base)
<p>IRBP(668-687) TFA, a segment of human IRBP, can cause uveitis.</p>Formula:C93H152F3N25O34Purity:98%Color and Shape:SolidMolecular weight:2221.34Interphotoreceptor retinoid-binding protein(668-687)
CAS:Interphotoreceptor retinoid-binding protein(668-687)is an amino acid residue of human retinoid-binding protein(IRBP) 668-687, which can induce uveitis.Formula:C91H151N25O32Purity:98%Color and Shape:SolidMolecular weight:2107.32Interphotoreceptor Retinoid Binding Protein Fragment (IRBP)
CAS:<p>IRBP Fragment is a 20-residue peptide in IRBP 161-180, causing post-uveitis (EAU).</p>Formula:C103H157N25O29Purity:98%Color and Shape:SolidMolecular weight:2209.5IRBP acetate(211426-18-5 free base)
<p>IRBP acetate is a 20-residue peptide epitope in IRBP 161-180, potentially causing uveitis.</p>Formula:C105H161N25O31Purity:95.54%Color and Shape:SolidMolecular weight:2269.55IGF-I (30-41) TFA(82177-09-1,FREE)
<p>IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).</p>Formula:C51H83N19O19·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:1380.36IGF-I (30-41)
CAS:IGF-I (30-41) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).Formula:C51H83N19O19Purity:98%Color and Shape:SolidMolecular weight:1266.34IGF-I 30-41 acetate(82177-09-1 free base)
<p>IGF-I 30-41 acetate(82177-09-1 free base) (Insulin-like Growth Factor I (30-41) acetate) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I</p>Formula:C53H87N19O21Purity:99.21%Color and Shape:SolidMolecular weight:1326.39IGF-I (24-41) TFA (135861-49-3 free base)
IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.Formula:C88H133N27O28·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:2131.18IGF-I (24-41)
CAS:<p>IGF-I (24-41) is a fragment of IGF-I, affecting GH activities with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.</p>Formula:C88H133N27O28Purity:98%Color and Shape:SolidMolecular weight:2017.16Insulin(cattle)
CAS:<p>Insulin(cattle) is a peptide hormone that promotes glycogen synthesis. Insulin) has hypoglycemic activity. Cost-effective and quality-assured.</p>Formula:C254H377N65O75S6Purity:98%Color and Shape:SolidMolecular weight:5733.49InsB 9-23
<p>InsB (9-23) is an insulin B-chain peptide that binds to a class II histocompatibility complex (MHC) allele called I-Ag7.</p>Formula:C72H116N20O22S1Purity:98%Color and Shape:SolidMolecular weight:1645.9Nemifitide diTFA
CAS:<p>Nemifitide diTFA is a synthetic pentapeptide with antidepressant properties, resembling MIF, that crosses the blood-brain barrier.</p>Formula:C37H45F7N10O10Purity:99.78% - 99.84%Color and Shape:SolidMolecular weight:922.8Nemifitide acetate(173240-15-8 free base)
<p>Nemifitide acetate, synthetic 5-amino acid antidepressant, has quick effect, mimics MIF.</p>Formula:C35H47FN10O8Purity:97.97%Color and Shape:SolidMolecular weight:754.85Ac-IEPD-AFC
CAS:Ac-IEPD-AFC (IEPD) is a fluorescent substrate for granzyme B and can be used to measure granzyme B activity.Formula:C32H38F3N5O11Purity:99.16%Color and Shape:SolidMolecular weight:725.67Boc-Ile-Glu-Gly-Arg-AMC
CAS:<p>Boc-IEGR-AMC: fluorogenic substrate for factor Xa and Halocynthia roretzi acrosin.</p>Formula:C34H50N8O10Purity:98%Color and Shape:White PowderMolecular weight:730.81β-CGRP, human
CAS:<p>β-CGRP, human ,a 37-amino acid peptide,is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular</p>Formula:C162H267N51O48S3Purity:98%Color and Shape:SolidMolecular weight:3793.41β-CGRP, human TFA (101462-82-2 free base)
<p>β-CGRP,human tissue is one of the calcitonin peptide, through complex behavior of calcitonin receptor like receptor (CRLR) - and receptor activity - modifying</p>Formula:C164H268F3N51O50S3Purity:98%Color and Shape:SolidMolecular weight:3907.38β-Casomorphin, human TFA (102029-74-3 free base)
<p>β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) an opioid peptide that ACTS as an opioid receptor agonist.</p>Formula:C46H62F3N7O13Purity:98%Color and Shape:SolidMolecular weight:978.02HCGRP-(8-37)
CAS:Rat CGRP-(8-37) (VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF) is a highly selective CGRP receptor antagonistFormula:C139H230N44O38Purity:98%Color and Shape:SolidMolecular weight:3125.59HCGRP-(8-37) acetate
<p>HCGRP-(8-37) acetate is a human calcitonin gene-related peptide (hCGRP) fragment acetate and also an antagonist of CGRP receptor.</p>Formula:C141H234N44O40Purity:99.29%Color and Shape:SolidMolecular weight:3185.64Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Formula:C132H221N44F3O42Purity:98%Color and Shape:SolidMolecular weight:3153.48Secretin (28-54), human
CAS:Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.Formula:C130H220N44O40Purity:98%Color and Shape:PowderMolecular weight:3039.46Pancreatic Polypeptide, human
CAS:<p>Endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.</p>Formula:C185H287N53O54S2Purity:98%Color and Shape:SolidMolecular weight:4181.71Pancreatic Polypeptide (human) acetate
Pancreatic Polypeptide (human) acetate is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.Purity:97.26%Color and Shape:LiquidMolecular weight:N/AOrexin B, human TFA (205640-91-1 free base)
<p>Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.</p>Formula:C123H212N44O35S·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3013.36Orexin B, human
CAS:Orexin B, human agonizes Orexin receptors (OX1 Ki=420 nM, OX2 Ki=36 nM), promotes feeding in rats, and is a neuropeptide.Formula:C123H212N44O35SPurity:98%Color and Shape:SolidMolecular weight:2899.34Neuropeptide Y (human)
CAS:<p>Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.</p>Formula:C189H285N55O57SPurity:98%Color and Shape:SolidMolecular weight:4271.68Neuropeptide Y (29-64), amide, human acetate
Neuropeptide Y (29-64), amide, human acetate is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.Purity:98.42%Color and Shape:LiquidMolecular weight:N/AGLP-1(7-36), amide acetate
CAS:GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68Fibrinopeptide A, human TFA
CAS:Human fibrinopeptide A, a 16-residue peptide, is thrombin-cleaved from fibrinogen's Aα chain NH2-terminus, aiding fibrin polymerization.Formula:C67H99F6N19O30Purity:98%Color and Shape:SolidMolecular weight:1764.6Fibrinopeptide A, human
CAS:Human Fibrinopeptide A: 16-residue peptide from fibrinogen's Aα region, cleaved by thrombin.Formula:C63H97N19O26Purity:98%Color and Shape:White Lyophilized PowderMolecular weight:1536.56Fibrinopeptide A, human acetate
Human Fibrinopeptide A acetate is a 16-amino acid peptide from fibrinogen's N-terminal Aα, cleaved by thrombin.Formula:C65H101N19O28Purity:>99.99%Color and Shape:SolidMolecular weight:1596.65Corticotropin-releasing factor (human)
CAS:Human CRF is a neuropeptide that releases ACTH, stimulates the nervous system, and antagonizes inflammation.Formula:C208H344N60O63S2Purity:98%Color and Shape:SolidMolecular weight:4757.45Corticotropin-releasing factor (human) acetate
Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.Purity:98.30%Color and Shape:LiquidAdrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human (TFA) is an NH2 terminal truncated adrenomedullin analogue,affects cell proliferation and angiogenesis in cancer.Formula:C266H407F3N80O79S3Purity:98%Color and Shape:SolidMolecular weight:6142.76Adrenomedullin (AM) (1-52), human
CAS:Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formula:C264H406N80O77S3Purity:98%Color and Shape:SolidMolecular weight:6028.82Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5Glucagon-like peptide 1 (1-37), human
CAS:<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Formula:C186H275N51O59Purity:98%Color and Shape:SolidMolecular weight:4169.48Glucagon-like peptide 1 (1-37), human acetate
Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.Purity:98%Color and Shape:LiquidMolecular weight:N/AHIV-1 Rev (34-50)
CAS:HIV-1 Rev (34-50) (HIV-1 rev Protein (34-50)) is a 17 amino acid peptide with anti-HIV-1 activity.Formula:C97H173N51O24Purity:99.91%Color and Shape:SolidMolecular weight:2437.74Gly6
CAS:Gly6 is a linear peptide with six amino acids.Formula:C12H20N6O7Purity:98%Color and Shape:White To Off- White PowderMolecular weight:360.32Fibronectin Adhesion-promoting Peptide TFA
Fibronectin peptide aids MSC aggregation by heparin-binding, promoting spheroid assembly.Formula:C49H75F3N16O12Purity:98%Color and Shape:SolidMolecular weight:1137.22Fibronectin Adhesion-promoting Peptide
CAS:Heparin-binding peptide aids adhesion, part of fibronectin's carboxy-terminal domain.Formula:C47H74N16O10Purity:98%Color and Shape:SolidMolecular weight:1023.19Fibronectin Adhesion-promoting Peptide acetate
<p>Fibronectin Adhesion-promoting Peptide acetate is a heparin-binding sequence from fibronectin's carboxy-terminal.</p>Formula:C49H78N16O12Purity:>99.99%Color and Shape:SolidMolecular weight:1083.25Exendin-4 peptide derivative acetate
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.Purity:98%Color and Shape:SolidMolecular weight:N/AHuman growth hormone-releasing factor
CAS:<p>GHRH from the hypothalamus prompts the pituitary to produce/release GH by attaching to the GHRHR.</p>Formula:C215H358N72O66SPurity:98%Color and Shape:SolidMolecular weight:5039.65Human growth hormone-releasing factor acetate
Human growth hormone-releasing factor acetate is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) onPurity:99.26%Color and Shape:LiquidMolecular weight:N/AH-Gly-Gly-Pro-OH
CAS:H-Gly-Gly-Pro-OH (Glycyl-glycyl-L-proline) is a dipeptide composed of glycine and proline, and is an end product of collagen metabolism.Formula:C9H15N3O4Purity:97.44%Color and Shape:SolidMolecular weight:229.23GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19Copper tripeptide
CAS:GHK-Cu is a copper complex with the peptide glycyl-L-histidyl-L-lysine, found in human plasma, saliva, and urine.Formula:C14H22CuN6O4Purity:99.94% - >99.99%Color and Shape:SolidMolecular weight:401.91Boc-Gly-Gly-Phe-Gly-OH
CAS:Boc-Gly-Gly-Phe-Gly-OH is a self-assembly of N- and C-protected tetrapeptide.Formula:C20H28N4O7Color and Shape:SolidMolecular weight:436.46Boc-Gly-Gly-Phe-Gly-OH acetate
<p>Boc-Gly-Gly-Phe-Gly-OH acetate (GGFG acetate) is a self-assembly of N- and C-protected tetrapeptide.</p>Formula:C22H32N4O9Purity:99.86%Color and Shape:SolidMolecular weight:496.52Hexa-D-arginine TFA
CAS:<p>Hexa-D-arginine TFA (Furin Inhibitor II TFA) is an inhibitor of furin (Ki values are 0.106, 0.58 and 13.2 μM for furin, PACE4 and PC1 respectively).</p>Formula:C38H76F3N25O8Purity:98%Color and Shape:SolidMolecular weight:1068.17Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Fibrinopeptide B, human TFA (36204-23-6 free base)
<p>FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment.</p>Formula:C68H94F3N19O27Purity:98%Color and Shape:SolidMolecular weight:1666.58Fibrinopeptide B, human
CAS:Fibrinopeptide B (FPB) is produced during the cleavage of fibrinogen, by thrombin, to fibrin monomer.Formula:C66H93N19O25Purity:98%Color and Shape:SolidMolecular weight:1552.56N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys TFA
<p>FPR agonist, chemoattracts neutrophils, retains activity when radioiodinated.</p>Formula:C45H66F3N7O11Purity:97.1%Color and Shape:SolidMolecular weight:938.04ZINC77292789
CAS:ZINC77292789 (Fmoc-Thr[GalNAc(Ac)3-α-D]-OH) is a reagent for the preparation of a synthetic MUC1 Glycopeptide Bearing βGalNAc-Thr as a Tn antigen isomer whichFormula:C33H38N2O13Purity:99.24%Color and Shape:SolidMolecular weight:670.66Fmoc-Arg-OH
CAS:Fmoc-Arg-OH (Fmoc-L-Arginine) (Fmoc-L-Arginine) is a used in peptide synthesis.Formula:C21H24N4O4Purity:>99.99%Color and Shape:White SolidMolecular weight:396.44N-Formyl-Met-Leu-Phe-Lys
CAS:<p>fMLFK: potent FPR1 agonist; EC50=3.5 nM (FPR1), 6.7 μM (FPR2), 0.88 μM (FPR2-D2817.32G); binds leukocytes; aids neutrophil assessment.</p>Formula:C27H43N5O6SPurity:99.7%Color and Shape:SolidMolecular weight:565.73Flagelin 22 TFA (304642-91-9 free base)
<p>Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.</p>Formula:C95H163F3O36N32Purity:98%Color and Shape:SolidMolecular weight:2386.53Flagelin 22
CAS:Flagelin 22, a bacterial flagellin fragment, serves as a potent elicitor for plants and algae.Formula:C93H162N32O34Purity:98%Color and Shape:SolidMolecular weight:2272.48Flagelin 22 acetate
Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.Formula:C95H166N32O36Purity:95.93%Color and Shape:SolidMolecular weight:2332.56Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Formula:C172H263N43O52·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3879.27Apraglutide
CAS:Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formula:C172H263N43O52Purity:98%Color and Shape:SolidMolecular weight:3765.25Endothelin-3 (Rat,Human) (TFA)
<p>Endothelin-3 (Rat, Human) (TFA) is a 21-amino acid vasoactive peptide of endothelial origi, an agonist for the endothelin receptor type B (EDNRB).</p>Formula:C123H169F3N26O35S4·xC2HF3O2Purity:98%Color and Shape:SolidMolecular weight:2757.07 (free base)Endothelin-2 (49-69), human
CAS:Endothelin-2 (49-69), human (Human endothelin-2) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.Formula:C115H160N26O32S4Purity:98.26%Color and Shape:SolidMolecular weight:2546.92Endothelin-3, human, mouse, rabbit, rat
CAS:<p>Endothelin-3, human, mouse, rabbit, rat , is a cyclic 21 amino acid peptide. It is an endogenous neuropeptide and potent vasoconstrictor.</p>Formula:C121H168N26O33S4Purity:98%Color and Shape:SolidMolecular weight:2643.04Eledoisin
CAS:<p>Eledoisin (Eledone peptide) is a specific agonist of NK2 and NK3 receptors.Eledoisin is an undecapeptide of mollusk origin, belonging to the tachykinin family</p>Formula:C54H85N13O15SPurity:98%Color and Shape:SolidMolecular weight:1188.4Porcine dynorphin A(1-13)
CAS:Porcine dynorphin A (1-13) is a potent κ opioid receptor agonist; it's antinociceptive and raises [Ca2+]i in neurons like NMDA.Formula:C75H126N24O15Purity:98%Color and Shape:SolidMolecular weight:1603.95Porcine dynorphin A(1-13) acetate
<p>Porcine dynorphin A(1-13) acetate is a potent κ-opioid agonist with antinociceptive properties, increasing [Ca2+]i like NMDA.</p>Formula:C77H130N24O17Purity:99.14%Color and Shape:SolidMolecular weight:1664Dolastatin 10
CAS:Dolastatin 10 (DLS 10) is a powerful peptide with antimitotic properties, effectively inhibiting tubulin polymerization.Formula:C42H68N6O6SPurity:99.00%Color and Shape:SolidMolecular weight:785.09Bradykinin (2-9)
CAS:Bradykinin (2-9) (Des-Arg1-bradykinin) is an amino-truncated peptide compound that is a metabolite of Bradykinin.Formula:C44H61N11O10Purity:>99.99%Color and Shape:SolidMolecular weight:904.02Amylin, amide, human
CAS:Amylin, amide, human(DAP Amide) is a 37-amino acid peptide hormone co-secreted with insulin to regulate postprandial glucose levels.Formula:C165H261N51O55S2Purity:98%Color and Shape:SolidMolecular weight:3903.28Cys-TAT(47-57)
CAS:Cys-TAT(47-57): arginine-rich peptide from HIV-1 TAT protein's transduction domain.Formula:C67H124N34O14SPurity:98%Color and Shape:SolidMolecular weight:1661.99Cys-TAT(47-57) acetate(583836-55-9 Free base)
Cys-TAT(47-57) acetate is derived from the HIV-1 transactivating protein. Cys-TAT(47-57) acetate is an arginine rich peptide that can penetrate cells.Formula:C69H128N34O16SPurity:95.1100%Color and Shape:SolidMolecular weight:1722.04Cyclo(Phe-Pro)
CAS:Cyclo(Phe-Pro) (A-64863) known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Formula:C14H16N2O2Purity:98.27%Color and Shape:SolidMolecular weight:244.29Cyclo(Phe-Pro) acetate(14705-60-3 free base)
Cyclo(Phe-Pro) acetate(14705-60-3 free base), known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Formula:C16H20N2O4Purity:98%Color and Shape:SolidMolecular weight:304.35C-Type Natriuretic Peptide (CNP) (1-22), human
CAS:C-Type Natriuretic Peptide (CNP) (1-22), human is the 1-22 fragment of C-Type Natriuretic Peptide.Formula:C93H157N27O28S3Purity:>99.99%Color and Shape:SolidMolecular weight:2197.6Cortistatin 14, human, rat
CAS:<p>Cortistatin 14: a neuropeptide similar to somatostatin; induces sleep, depresses neuronal activity; found in cortex, hippocampus.</p>Formula:C81H113N19O19S2Purity:98%Color and Shape:SolidMolecular weight:1721.01Cortistatin 14, human, rat acetate
Cortistatin 14, human, rat acetate is a neuropeptide having structural similarity to somatostatin-14 and shows anticonvulsive, neuroprotective effects andFormula:C80H112N18O19S2Purity:97.86%Color and Shape:SolidMolecular weight:1693.98C-Peptide, dog
CAS:Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.Formula:C137H225N37O49Purity:98%Color and Shape:SolidMolecular weight:3174.47CRF, bovine TFA (92307-52-3 free base)
<p>CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.</p>Formula:C208H341F3N60O65SPurity:98%Color and Shape:SolidMolecular weight:4811.36CRF, bovine
CAS:CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.Formula:C206H340N60O63SPurity:98%Color and Shape:SolidMolecular weight:4697.34Conopressin S
CAS:Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Formula:C41H73N17O10S2Purity:98%Color and Shape:SolidMolecular weight:1028.26Conopressin S acetate(111317-90-9 free base)
<p>Conopressin S acetate(111317-90-9 free base) (Con-S acetate) is a natural product isolated from Conus striatus, shows high affinity with vasopressin V1b</p>Formula:C43H77N17O12S2Purity:99.79%Color and Shape:SolidMolecular weight:1088.32C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Formula:C37H62F3N13O12Purity:98%Color and Shape:SolidMolecular weight:937.96Cibinetide
CAS:<p>Cibinetide (ARA290) is a nonerythropoietic peptide engineered from erythropoietin,, and used for neurological disease treatment.</p>Formula:C51H84N16O21Purity:≥95%Color and Shape:SolidMolecular weight:1257.31D-Lys(Z)-Pro-Arg-pNA
CAS:D-Lys(Z)-Pro-Arg-pNA is a luminescent substrate of activated protein C (APC).Formula:C31H43N9O7Purity:98%Color and Shape:SolidMolecular weight:653.73Sincalide
CAS:Sincalide (CCK-8) is an injectable drug used to diagnose gallbladder and pancreas disorders; it's a cholecystokinin fragment.Formula:C49H62N10O16S3Purity:98.32%Color and Shape:SolidMolecular weight:1143.27Sincalide ammonium
CAS:<p>Sincalide ammonium, a CCK analog, stimulates bile release, gallbladder contraction, and sphincter relaxation, aiding in diagnoses.</p>Formula:C49H65N11O16S3Purity:98.46%Color and Shape:SolidMolecular weight:1160.3Urotensin I
CAS:Urotensin I, 41-aa neuropeptide, agonist for human/rat CRF receptors, lowers blood pressure in rats, isolated from white suckers.Formula:C210H340N62O67S2Purity:98%Color and Shape:SolidMolecular weight:4869.46Urotensin I acetate (83930-33-0 Free base)
Urotensin I acetate, CRF1/CRF2 agonist: pEC50s - hCRF1 11.46, hCRF2 9.36, rCRF2α 9.85; KIs - hCRF1 0.4 nM, rCRF2α 1.8 nM, mCRF2β 5.7 nM.Purity:95.44% - 99.73%Color and Shape:SolidMolecular weight:N/ACGRP (83-119), rat TFA
CGRP (83-119), rat TFA (Calcitonin Gene Related Peptide(83-119), rat TFA) is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptorFormula:C162H262N50O52S2·C2HF3O2Purity:>99.99%Color and Shape:SolidMolecular weight:3920.32CGRP II, rat (TFA) (99889-63-1 free base)
Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) is a neuropeptide with 37 amino acid.Formula:C165H268F3N51O52S2Purity:98%Color and Shape:SolidMolecular weight:3919.33Calcitonin Gene Related Peptide (CGRP) II, rat
CAS:<p>CGRP II is a potent vasodilator that boosts pancreatic enzyme levels by activating β-cell receptors.</p>Formula:C163H267N51O50S2Purity:98%Color and Shape:SolidMolecular weight:3805.31CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purity:98%Color and Shape:SolidMolecular weight:3806.3iRGD peptide
CAS:<p>iRGD peptide: 9-amino acid cyclic compound (CRGDKGPDC), found through phage display in mice with tumors.</p>Formula:C35H57N13O14S2Purity:98.77%Color and Shape:SolidMolecular weight:948.04Velmupressin acetate
CAS:Potent, selective, short-acting peptidic V2R agonist; EC50: 0.07 nM (hV2R), 0.02 nM (rV2R).Formula:C44H64ClN11O10S2Purity:98%Color and Shape:SolidMolecular weight:1006.63BNP-45 (rat) (TFA) (123337-89-3 free base)
<p>BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.</p>Formula:C215H350N71O67F3S3Purity:98%Color and Shape:SolidMolecular weight:5154.69Brain Natriuretic Peptide-45, rat
CAS:BNP-45 (rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.Formula:C213H349N71O65S3Purity:98%Color and Shape:SolidMolecular weight:5040.67Nesiritide
CAS:<p>Nesiritide, recombinant human B-type natriuretic peptide, binds NPR-A/C with Kd 7.3/13 pM.</p>Formula:C143H244N50O42S4Purity:98%Color and Shape:SolidMolecular weight:3464.04BNP (1-32), rat TFA (133448-20-1 free base)
Cardiac hormone aiding natriuresis, diuresis, vasorelaxation; regulates cardio homeostasis and heart function.Formula:C146H239N47O44S3·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3566.96Bradykinin (1-7)
CAS:Bradykinin (1-7), an amino-truncated peptide derived from Bradykinin, is a metabolite formed through enzymatic cleavage by endopeptidase.Formula:C35H52N10O9Purity:98%Color and Shape:White Lyophilized PowderMolecular weight:756.85BAM-22P
CAS:Bovine adrenal medulla docosapeptide (BAM-22P) is a potent opioid agonist, derived from the proenkephalin A gene, which is present in the adrenal medulla.Formula:C130H184N38O31S2Purity:98%Color and Shape:SolidMolecular weight:2839.22BAM 22P acetate
<p>BAM 22P acetate is a potent opioid agonist.</p>Formula:C132H188N38O33S2Purity:99.87%Color and Shape:SoildMolecular weight:2899.27N-Boc-Phe-Leu-Phe-Leu-Phe
CAS:Boc-FLFLF is an FPR1 antagonist that enhances pain and blocks annexin's antinociception, used in FPR studies.Formula:C44H59N5O8Purity:>99.99%Color and Shape:SolidMolecular weight:785.97β-Amyloid 15-21
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease. This fragment is involved in beta sheet formation.Formula:C43H65N9O9Purity:98%Color and Shape:SolidMolecular weight:852.03β-Amyloid 15-21 acetate
β-Amyloid 15-21 acetate (Beta-Amyloid (15-21) acetate) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.Formula:C45H69N9O11Purity:99.62%Color and Shape:SolidMolecular weight:912.1Abaloparatide TFA
Abaloparatide TFA (BIM 44058 TFA) is a parathyroid hormone-related protein (PTHrP) analog drug used to treat osteoporosis like the related drug teriparatide.Formula:C176H301N56F3O51Purity:99.76%Color and Shape:SolidMolecular weight:4074.61Abaloparatide acetate(247062-33-5 free base)
<p>Abaloparatide acetate is a parathyroid hormone receptor 1 PTHR1 analogue and an effective and selective activator of the PTHR1 signaling pathway.</p>Formula:C176H304N56O51Purity:95.66%Color and Shape:SolidMolecular weight:4020.71CaM kinase II inhibitor TFA salt
<p>CaM kinase II inhibitor TFA salt (Autocamtide-2-related inhibitory peptide (TFA)) is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.</p>Formula:C66H117F3N22O21Purity:>99.99%Color and Shape:SolidMolecular weight:1611.77Autocamtide 2
CAS:<p>Autocamtide-2: Selective peptide for CaMKII, a CAMK Ser/Thr kinase.</p>Formula:C65H118N22O20Purity:98%Color and Shape:White PowderMolecular weight:1527.77Autocamtide 2 TFA(129198-88-5 free base)
<p>Autocamtide 2 TFA, selective CaMKII peptide substrate, used in its activity assay.</p>Formula:C67H119F3N22O22Purity:98%Color and Shape:SolidMolecular weight:1641.79Atrial natriuretic factor (1-28) (rat) TFA
ANP (1-28), rat (TFA) inhibits Ang II-induced endothelin-1 secretion; main circulating ANP form in rats.Formula:C130H206N45F3O41S2Purity:98%Color and Shape:SolidMolecular weight:3176.43Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate
CAS:Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate is an NPR-A agonist and ANP hormone. Carperitide increases cGMP levels and reduces the heart's workload.Formula:C129H207N45O41S3Purity:99.78%Color and Shape:SoildMolecular weight:3140.5ANP(1-28) Acetate (human, porcine)
CAS:<p>Carperitide acetate: 28-amino acid hormone from human heart, counters cardiac injury/stretch, reduces endothelin-1.</p>Formula:C129H207N45O41S3Purity:98.24%Color and Shape:SolidMolecular weight:3140.5Atrial Natriuretic Peptide (ANP) (1-28), rat
CAS:Atrial Natriuretic Peptide (1-28), rat is the major circulating form of ANP in rats.Formula:C128H205N45O39S2Purity:98%Color and Shape:SolidMolecular weight:3062.41Apamin TFA (24345-16-2 free base)
Apamin TFA: bee venom toxin; blocks Ca2+-activated K+ channels (SK, KCa2), strongest on SK2.Formula:C81H132F3N31O26S4Purity:98%Color and Shape:SolidMolecular weight:2141.36Apamin
CAS:<p>Apamin: 18-amino acid bee venom peptide, blocks SK channels, anti-inflammatory, anti-fibrotic, strongly basic.</p>Formula:C79H131N31O24S4Purity:98%Color and Shape:SolidMolecular weight:2027.34Apamin acetate
<p>Apamin acetate: Selective Ca2+-activated K+ channel blocker, 18-amino acid bee venom peptide, promotes synapse repair, anti-inflammatory.</p>Purity:96.97%Color and Shape:Solid[Sar1, Ile8]-Angiotensin II TFA
[Sar1,Ile8]-Angiotensin II (TFA) contracts arteries and affects cell growth in vascular muscle.Formula:C48H74F3N13O12Purity:98%Color and Shape:SolidMolecular weight:1082.18β-Amyloid (22-35)
CAS:β-Amyloid (22-35) is a 14-aa peptide, shows aggregates and induces neurotoxicity in the hippocampal cells.Formula:C59H102N16O21SPurity:98%Color and Shape:SolidMolecular weight:1403.62β-Amyloid (1-28)
CAS:β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding.Formula:C145H209N41O46Purity:98%Color and Shape:SolidMolecular weight:3262.51β-Amyloid (12-28)
CAS:Amyloid β-peptide fragment; minimum section required to bind to brain proteins.Formula:C89H135N25O25Purity:98%Color and Shape:SolidMolecular weight:1955.18β-Amyloid (1-16)
CAS:β-Amyloid (1-16) is an amyloidogenic protein fragment with a sequence derived from β-amyloid.Formula:C84H119N27O28Purity:98%Color and Shape:SolidMolecular weight:1955.04β-Amyloid (1-15)
CAS:β-Amyloid (1-15) (Amyloid β-Protein (1-15)) is a fragment of β-amyloid protein used in the study of Alzheimer's disease.Formula:C78H107N25O27Purity:99.88%Color and Shape:SolidMolecular weight:1826.84β-Amyloid (1-42), rat/mouse
CAS:<p>β-Amyloid (1-42), rat/mouse is a polypeptide composed of 42 amino acids. It is toxic to hippocampal slices and can be used in the study of alzheimer's disease.</p>Formula:C199H307N53O59SPurity:98%Color and Shape:SolidMolecular weight:4418.02β-Amyloid (29-40)
CAS:<p>β-Amyloid (29-40) is a fragment of Amyloid-β peptide.Alzheimer's beta amyloid peptide (29-40/42) C-terminal fragments have physical and chemical properties</p>Formula:C49H88N12O13SPurity:98%Color and Shape:SolidMolecular weight:1085.36Amylin, amide, rat
CAS:Amylin: peptide, 50% similar to CGRP, found with somatostatin in stomach cells, reduces acid secretion in mice.Formula:C167H272N52O53S2Purity:99.92%Color and Shape:SolidMolecular weight:3920.44Amylin, amide, rat acetate(124447-81-0,free base)
Amylin, amide, rat acetate is a potent and high affinity ligand of AMY1 and AMY3 receptors and variably of AMY2 receptors.Formula:C169H276N52O55S2Purity:98.93%Color and Shape:SolidMolecular weight:3980.45Amylin (8-37), rat
CAS:Amylin (8-37), rat, an analog of IAPP, blocks insulin's effects on muscle glucose uptake and glycogen storage.Formula:C140H227N43O43Purity:98%Color and Shape:SolidMolecular weight:3200.61Amlodipine aspartic acid impurity
CAS:Amlodipine aspartic acid: a calcium blocker with antihypertensive effects; contains specific impurities.Formula:C24H29ClN2O9Purity:98%Color and Shape:SolidMolecular weight:524.95Etelcalcetide
CAS:<p>Etelcalcetide (AMG 416), a synthetic peptide CaSR activator, treats secondary hyperparathyroidism in hemodialysis patients.</p>Formula:C38H73N21O10S2Purity:98%Color and Shape:SolidMolecular weight:1048.26Etelcalcetide hydrochloride
CAS:<p>Etelcalcetide HCl, a synthetic peptide modulator of CaSR, lowers PTH in dialysis patients with secondary hyperparathyroidism.</p>Formula:C38H73N21O10S2HClPurity:>99.99%Color and Shape:SolidMolecular weight:1353.33ACTH (1-14) TFA (25696-21-3 free base)
<p>ACTH (1-14) (TFA) is a polypeptide of corticotrophin, which promotes the release of cortisol.</p>Formula:C79H110F3N21O22SPurity:98%Color and Shape:SolidMolecular weight:1794.9ACTH (1-14)
CAS:ACTH (1-14) is a pituitary hormone fragment that controls cortisol and androgen levels.Formula:C77H109N21O20SPurity:98%Color and Shape:SolidMolecular weight:1680.88ACTH 1-14 acetate(25696-21-3 free base)
<p>ACTH 1-14 acetate regulates cortisol and androgen, is part of the hypothalamic-pituitary-adrenal stress response.</p>Formula:C79H113N21O22SPurity:>99.99%Color and Shape:SolidMolecular weight:1740.96ACTH (18-39) TFA (human)
CAS:<p>Adrenocorticotropic Hormone (ACTH) (18-39), human TFA (CLIP human TFA) is a corticotropinlike intermediate lobe peptide, produced by melanotropic cells.</p>Formula:C114H166F3N27O38Purity:>99.99%Color and Shape:SolidMolecular weight:2579.69Adrenocorticotropic Hormone (ACTH) (18-39), human
CAS:ACTH (18-39), or Corticotropin-like Peptide, boosts insulin, amylase, and protein secretion dose-dependently.Formula:C112H165N27O36Purity:98%Color and Shape:SolidMolecular weight:2465.671-39-Corticotropin (human)(TFA)
ACTH (1-39) human (TFA) is a melanocortin agonist that boosts adrenal CS production and affects the CNS and immune system.Formula:C207H308N56O58S·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:4655.16Adrenocorticotropic Hormone (ACTH) (1-10), human
CAS:<p>ACTH (1-10), human: a weak α-MSH mimic at high doses (100-1000 nM), derived from adrenocorticotropin.</p>Formula:C59H78N16O16SPurity:98%Color and Shape:SolidMolecular weight:1299.41ACTH (1-10) Acetate (human)
ACTH (1-10), human acetate is a segment of adrenocorticotropin with low α-MSH activity at 100-1000 nM.Formula:C61H82N16O18SPurity:99.35%Color and Shape:SolidMolecular weight:1359.46ACTH (4-11)
CAS:ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.Formula:C50H71N15O11SPurity:98%Color and Shape:SolidMolecular weight:1090.26ACTH 4-11 acetate
ACTH 4-11 acetate, a fragment of adrenocorticotropin, matches α-MSH's sequence and has weak MSH potency at high doses (100-1000 nM).Formula:C52H75N15O13SPurity:99.21%Color and Shape:SolidMolecular weight:1150.31ACTH (22-39)
CAS:<p>ACTH (22-39) is an adrenocorticotropic hormone (ACTH) fragment and it is the 22-39 sequence of ACTH.</p>Formula:C90H125N19O32Purity:98%Color and Shape:SolidMolecular weight:1985.06ACTH (22-39) acetate
ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.Formula:C92H129N19O34Purity:98.14%Color and Shape:SolidMolecular weight:2045.12ACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Formula:C75H106N20O19SPurity:98%Color and Shape:SolidMolecular weight:1623.83ACTH (11-24)
CAS:ACTH (11-24) is an adrenocorticotrophin fragment, stimulates cortisol, and antagonizes ACTH (1-39)/(1-10) in adrenal cells.Formula:C77H134N24O16Purity:98%Color and Shape:SolidMolecular weight:1652.04ACTH 11-24 acetate(4237-93-8 free base)
CAS:ACTH 11-24 acetate is a cortisol-stimulating adrenocorticotrophin fragment and a competitive antagonist of ACTH 1-39 and 1-10.Formula:C79H138N24O18Purity:>99.99%Color and Shape:SolidMolecular weight:1712.12Adrenocorticotropic Hormone (ACTH) (1-39), rat
CAS:ACTH (1-39), rat: potent MC2 agonist, forms fragments in vitro, isolated by HPLC, characterized by amino acids and NH2-terminus.Formula:C210H315N57O57SPurity:98%Color and Shape:SolidMolecular weight:4582.23Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
<p>Acetyl-PHF6 amide TFA is a tau derived hexapeptide.</p>Formula:C40H64F3N9O11Purity:98%Color and Shape:SolidMolecular weight:903.99Acetyl-PHF6 amide acetate
Acetyl-PHF6 amide acetate(878663-43-5 freebase) (AcPHF6 acetate) is a tau derived hexapeptide.Formula:C40H67N9O11Purity:>99.99%Color and Shape:SolidMolecular weight:850.01N-terminally acetylated Endomorphin-1
N-terminally acetylated Endomorphin-1 is a modified Endomorphin-1.Formula:C36H40N6O6Purity:98%Color and Shape:SolidMolecular weight:652.74N-terminally acetylated Endomorphin-1 acetate
<p>N-terminally acetylated Endomorphin-1 acetate (Ac-L-Tyr-L-Pro-L-Trp-L-Phe-CONH2) is a modified Endomorphin-1.</p>Formula:C38H44N6O8Purity:99.67%Color and Shape:SolidMolecular weight:712.79N-terminally acetylated Leu-enkephalin acetate
N-terminally acetylated Leu-enkephalin is the N-terminally acetylated form of Leu-enkephalin.Formula:C30H39N5O8Purity:98%Color and Shape:SolidMolecular weight:N/AArgireline
CAS:Argireline (Acetyl hexapeptide-3) is a peptide that inhibits neurotransmitter release, reducing wrinkles.Formula:C34H60N14O12SPurity:96.79% - 99.65%Color and Shape:White PowderMolecular weight:888.99[Met5]-Enkephalin, amide TFA
[Met5]-Enkephalin, amide TFA (5-Methionine-enkephalin amide (TFA)) is a δ opioid receptors agonist as well as putative ζ (zeta) opioid receptors.Formula:C29H37F3N6O8SPurity:99.81%Color and Shape:SolidMolecular weight:686.7[Met5]-Enkephalin, amide
CAS:[Met5]-Enkephalin, amide activates δ and ζ opioid receptors; has multiple forms and varying plasma levels.Formula:C27H36N6O6SPurity:98%Color and Shape:SolidMolecular weight:572.68Adrenomedullin (AM) (22-52), human TFA
<p>Adrenomedullin (AM) human (22-52) is a truncated NH2 TFA-modified adrenal medullary receptor antagonist.</p>Formula:C161H253N46F3O50Purity:98%Color and Shape:SolidMolecular weight:3690.06Adrenomedullin (AM) (22-52), human
CAS:<p>Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.</p>Formula:C159H252N46O48Purity:98%Color and Shape:SolidMolecular weight:3576.04Adrenomedullin (AM) (22-52), human acetate
Adrenomedullin (AM) (22-52), human acetate is an antagonist of calcitonin generelated peptide receptor in the hindlimb vascular bed of the cat and anFormula:C161H256N46O50Purity:99.42%Color and Shape:SolidMolecular weight:3636.09Somatostatin-28 (1-12)
CAS:Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Formula:C49H81N17O19SPurity:98%Color and Shape:SolidMolecular weight:1244.33
![[bAla8]-Neurokinin A(4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1100.webp&w=3840&q=75)
![[Leu5]-Enkephalin, amide acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1113L.webp&w=3840&q=75)
![[Met5]-Enkephalin, amide TFA](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1254.webp&w=3840&q=75)
![[Met5]-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1255.webp&w=3840&q=75)
