GPCR/Proteína-G
Os inibidores de GPCR/proteínas G são compostos que têm como alvo os receptores acoplados a proteínas G (GPCRs) e as proteínas G associadas, que desempenham papéis críticos na transmissão de sinais do exterior para o interior das células. Esses inibidores são essenciais para estudar as vias de sinalização mediadas por GPCRs, que estão envolvidas em numerosos processos fisiológicos, incluindo percepção sensorial, resposta imunológica e neurotransmissão. Os inibidores de GPCR também são importantes no desenvolvimento de medicamentos, pois muitos agentes terapêuticos têm como alvo esses receptores. Na CymitQuimica, oferecemos uma ampla gama de inibidores de GPCR/proteínas G de alta qualidade para apoiar sua pesquisa em farmacologia, biologia celular e áreas afins.
Subcategorias de "GPCR/Proteína-G"
- Receptor 5-HT(939 produtos)
- Receptor de adenosina(242 produtos)
- Receptor adrenérgico(2.945 produtos)
- Receptor de Bombesina(30 produtos)
- Receptor de Bradicinina(59 produtos)
- CXCR(148 produtos)
- CaSR(32 produtos)
- Receptor de Canabinóides(195 produtos)
- Receptor de Dopamina(407 produtos)
- Receptor Endotelina(76 produtos)
- Receptor GNRH(73 produtos)
- GPCR19(31 produtos)
- GRK(31 produtos)
- GTPase(21 produtos)
- Receptor Glucagon(165 produtos)
- Hedgehog/Smoothened(44 produtos)
- Receptor de Histamina(358 produtos)
- Receptor LPA(21 produtos)
- Receptor de Melatonina(24 produtos)
- Receptor OX(40 produtos)
- Receptor opioide(297 produtos)
- PAFR(11 produtos)
- PKA(48 produtos)
- Receptor S1P(17 produtos)
- SGLT(30 produtos)
- Receptor Sigma(46 produtos)
Exibir 18 mais subcategorias
Foram encontrados 5352 produtos de "GPCR/Proteína-G"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
ATMW-2
<p>ATMW-2 is an antagonist engineered using NeuralGenThesis (NGT) technology, specifically targeting the melanocortin 2 receptor (MC2R).</p>Fórmula:C27H29ClN2O4Cor e Forma:SolidPeso molecular:480.98Moperone
CAS:<p>Moperone (R 1658) is an antagonist of both the D2 dopamine receptor (D2 dopamine receptor) and the D3 dopamine receptor (D3 dopamine receptor), with IC50 values for each of 1.0 nM.</p>Fórmula:C22H26FNO2Cor e Forma:SolidPeso molecular:355.45Latanoprost tris(triethylsilyl) ether
CAS:<p>Latanoprosttris(triethylsilyl) ether is a precursor in the synthesis of Latanoprost, which serves as an agonist for the prostaglandin F2α (PGF2α) receptor, also known as the FP receptor.</p>Fórmula:C44H82O5Si3Cor e Forma:SolidPeso molecular:775.38Human growth hormone-releasing factor TFA
<p>Human growth hormone-releasing factor TFA is a hypothalamic peptide that promotes GH secretion by targeting pituitary GHRHR.</p>Fórmula:C217H359F3N72O68SCor e Forma:SolidPeso molecular:5153.67LY 344864 racemate
CAS:<p>LY 344864 racemate is a 5-HT1F receptor agonist.</p>Fórmula:C21H22FN3OPureza:99.75%Cor e Forma:SoildPeso molecular:351.42UKH-1114
CAS:<p>UKH-1114 is a potent σ2 receptor/Tmem97 agonist with a Ki value of 46 nM, demonstrating antinociceptive effects against mechanical hypersensitivity. This compound alleviates mechanical hypersensitivity in mice caused by nerve injury without inducing motor impairment and is a promising candidate for neuropathic pain research.</p>Fórmula:C22H24F3NOCor e Forma:SolidPeso molecular:375.43Ala5-Galanin (2-11)
CAS:<p>Ala5-Galanin (2-11) is a specific agonist for the galanin receptor 2 (GAL2R) with an affinity constant (Ki) of 258 nM [1].</p>Fórmula:C54H81N13O13Pureza:98%Cor e Forma:SolidPeso molecular:1120.3PF-9184
CAS:<p>PF-9184 inhibits human mPGES-1 selectively, with an IC50 of 16.5 nM, and reduces IL-1β-stimulated PGE2 production in vitro.</p>Fórmula:C21H14Cl2N2O4SPureza:97.43%Cor e Forma:SolidPeso molecular:461.32Phenylethanolamine A
CAS:<p>Phenylethanolamine A is a β-adrenergic agonist and a byproduct of the Ractopamine synthesis process.</p>Fórmula:C19H24N2O4Cor e Forma:SolidPeso molecular:344.40Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate
CAS:<p>Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate is an NPR-A agonist and ANP hormone. Carperitide increases cGMP levels and reduces the heart's workload.</p>Fórmula:C129H207N45O41S3Pureza:99.78%Cor e Forma:SoildPeso molecular:3140.5Imnopitant dihydrochloride
CAS:<p>Imnopitant dihydrochloride is a neurokinin NK1 receptor antagonist [1] .</p>Fórmula:C28H30Cl2F6N4OCor e Forma:SolidPeso molecular:623.46HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Fórmula:C20H31N7O9Pureza:98%Cor e Forma:SolidPeso molecular:513.5MAO-B-IN-3
<p>MAO-B-IN-3 is a reversible, selective inhibitor of monoamine oxidase B (MAO-B) with an IC50 of 96 nM and demonstrates affinity for the 5-HT6 receptor with a Ki</p>Fórmula:C24H25N3O2Pureza:98%Cor e Forma:SolidPeso molecular:387.47PAR-4 Agonist Peptide, amide
CAS:<p>PAR-4 Agonist Peptide, amide (AY-NH2) is an agonist of proteinase-activated receptor-4 (PAR-4).</p>Fórmula:C34H48N8O7Pureza:98%Cor e Forma:SolidPeso molecular:680.79FXR/TGR5 agonist 1
CAS:<p>FXR/TGR5 agonist 1 acts as an agonist on both FXR and TGR5 receptors and is utilized for treating fatty liver disease.</p>Fórmula:C31H32ClN3O3Cor e Forma:SolidPeso molecular:530.07Danshenol B
<p>Danshenol B is a natural product that can be used as a reference standard.</p>Fórmula:C22H26O4Cor e Forma:SolidPeso molecular:354.446Adenosine 2',5'-diphosphate sodium
CAS:<p>Adenosine 2',5'-diphosphate sodium is a competitive P2Y1 antagonist with non-selective antagonism at recombinant and human platelet P2X1 receptors.</p>Fórmula:C10H15N5NaO10P2Cor e Forma:SolidPeso molecular:450.19215-keto Latanoprost
CAS:<p>Latanoprost, a PG analog for ocular pressure, metabolizes into 15-keto latanoprost, a less potent variant reducing intraocular pressure and pupil size.</p>Fórmula:C26H38O5Cor e Forma:SolidPeso molecular:430.58Galanin-Like Peptide (porcine)
CAS:<p>Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide originally isolated from the porcine hypothalamus.</p>Fórmula:C281H443N81O78Pureza:98%Cor e Forma:SolidPeso molecular:6204.02Edg-2 receptor inhibitor 1
CAS:<p>Edg-2 receptor inhibitor 1 (SAR-100842) is an Edg-2 receptor inhibitor extracted (IC50: <0.1 μM).</p>Fórmula:C27H27NO5Pureza:99.47%Cor e Forma:SolidPeso molecular:445.51Benzomalvin A
CAS:<p>Benzomalvin A is a filamentous fungal secondary metabolite.</p>Fórmula:C24H19N3O2Cor e Forma:SolidPeso molecular:381.43Lys-γ3-MSH(human)
CAS:<p>Pro-opiomelanocortin (POMC) derived peptide that stimulates lipolysis</p>Fórmula:C128H193N45O39SPureza:98%Cor e Forma:SolidPeso molecular:3018.25Saterinone
CAS:<p>Saterinone: PDE III inhibitor, α-1-adrenoceptor antagonist, vasodilator, used for acute chronic heart failure, IC50 2.3x10^-5 M.</p>Fórmula:C27H30N4O4Pureza:98.23%Cor e Forma:SolidPeso molecular:474.55Teprotumumab
CAS:<p>Teprotumumab: human antibody, inhibits IGF-1R, used for thyroid eye diseases.</p>Pureza:SDS-PAGE:95.2%;SEC-HPLC:99.6%Cor e Forma:LiquidPeso molecular:145.62 kDaBesipirdine hydrochloride
CAS:<p>Besipirdine hydrochloride is a non-receptor-dependent cholinomimetic compound with cardiovascular activity that inhibits the uptake of biogenic amines.</p>Fórmula:C16H18ClN3Pureza:98.45%Cor e Forma:SoildPeso molecular:287.79CCR4 antagonist 3 hydrochloride
CAS:<p>Orally active CCR4 antagonist 3 hydrochloride with potent selectivity, IC50s: 22/50 nM; has antitumor properties.</p>Fórmula:C24H27Cl2N7O·xHClCor e Forma:SolidSB 258585
CAS:<p>SB 258585: Selective 5-HT6 antagonist, binds human receptors, used in cognitive and antipsychotic assays.</p>Fórmula:C18H22IN3O3SPureza:99.8%Cor e Forma:SoildPeso molecular:487.36Luseogliflozin
CAS:<p>Luseogliflozin inhibits SGLT2 for glucose uptake with 1.10 nM potency.</p>Fórmula:C23H30O6SCor e Forma:SolidPeso molecular:434.55CGRP 8-37 (rat)
CAS:<p>CGRP 8-37 (rat) is a CGRP receptor antagonist, a CGRP fragment with potential anti-injury effects that induces arterial relaxation.</p>Fórmula:C138H224N42O41Pureza:99.28%Cor e Forma:SolidPeso molecular:3127.51LCKLSL acetate
<p>LCKLSL acetate is a potent AnxA2 inhibitor, blocking tPA binding and plasmin production, with anti-angiogenic effects.</p>Fórmula:C32H61N7O10SPureza:99.9%Cor e Forma:SolidPeso molecular:735.93PACAP-related Peptide (human) (trifluoroacetate salt)
<p>Endogenous 29-amino acid PRP belongs to secretin/glucagon family, found in pancreas, adrenal glands, and some VIP tumors; secreted by CHO-K1 cells.</p>Cor e Forma:LiquidAD186
<p>AD186, a potent and selective S1R agonist, exhibits dissociation constants (Kis) of 2.7 nM for S1R and 27 nM for S2R.</p>Fórmula:C22H28N2Pureza:98%Cor e Forma:SolidPeso molecular:320.47S1R agonist 2 hydrochloride
<p>Compound 8b hydrochloride, a selective S1R agonist, exhibits affinity with K i s of 1.1 nM for S1R and 88 nM for S2R.</p>Fórmula:C21H28ClNOPureza:98%Cor e Forma:SolidPeso molecular:345.91GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Fórmula:C149H221N37O49Pureza:98%Cor e Forma:SolidPeso molecular:3314.62(p-Iodo-Phe7)-ACTH (4-10)
CAS:<p>(p-Iodo-Phe7)-ACTH (4-10), an ACTH derivative and MC receptor antagonist, inhibits α-MSH-induced grooming in rats.</p>Fórmula:C44H58IN13O10SCor e Forma:SolidPeso molecular:1087.98SSTR4 agonist-1
CAS:<p>SSTR4agonist-1 (Compound 47) is a selective agonist of the somatostatin receptor 4 (SSTR4), with an EC50 of 4.7 nM. It has a half-life of over 130 minutes in human liver microsomes.</p>Fórmula:C16H23N3O2Cor e Forma:SolidPeso molecular:289.37CB2 receptor agonist 2
CAS:<p>CB2 receptor agonist 2 (ZINC72105556): potent, Ki=8.5 nM, high selectivity for CB2.</p>Fórmula:C30H36N2O4Pureza:99.75%Cor e Forma:SolidPeso molecular:488.62RC-3095 TFA
CAS:<p>RC-3095 TFA (RC-3095 (TFA)) is a bombesin/gastrin-releasing peptide (BN/GRP) antagonist with potential anticancer activity.</p>Fórmula:C58H80F3N15O11Pureza:98%Cor e Forma:SolidPeso molecular:1220.34sGC activator 2
<p>sGC activator 2 (Compound 16a) acts as an activator of soluble guanylate cyclase (sGC), enhancing the production of cGMP and exhibiting vasoprotective and anti-inflammatory properties.</p>Fórmula:C21H21FN8O3Cor e Forma:SolidPeso molecular:452.44Icatibant
CAS:<p>Icatibant is a selective and specific antagonist of the bradykinin B2 receptor (IC50 and Ki: 1.07 nM and 0.798 nM respectively).</p>Fórmula:C59H89N19O13SPureza:98%Cor e Forma:White SolidPeso molecular:1304.525-HT7R antagonist 1 free base
CAS:<p>5-HT7R antagonist 1 (free base) is a G protein-biased antagonist for the 5-HT 7 R receptor, with a dissociation constant (K i) of 6.5 nM.</p>Fórmula:C14H17ClN4Cor e Forma:SolidPeso molecular:276.77Piperulin A
CAS:<p>Piperulin A effectively inhibits platelet-activating factor receptor (PAFR) by specifically blocking its binding to isolated rabbit platelet plasma membranes,</p>Fórmula:C23H28O6Cor e Forma:SolidPeso molecular:400.465-HT1AR agonist 2
<p>5-HT1AR Agonist 2 (Compound 4f) is a potent agonist of the 5-HT1A receptor with a Ki value of 10.0 nM. It also binds to SERT, D2, and 5-HT6 receptors with Ki values of 2.8 nM, 23 nM, and 192 nM, respectively. Furthermore, this compound demonstrates stability in microsomes and induces hypothermia in mice.</p>Fórmula:C31H31N5O3Cor e Forma:SolidPeso molecular:521.61Eloralintide sodium
<p>Eloralintide sodium (LY-3841136 sodium) is an AMYR (amylin receptor) agonist applicable for studying type 2 diabetes and obesity.</p>Fórmula:C201H319N49O65S2·xNaPureza:98.66%Cor e Forma:SolidPeso molecular:4526.1 (free base)γ-Glu-Abu TFA
<p>Gamma-Glu-AbuTFA is the TFA salt form of Gamma-Glu-Abu. This compound acts as an agonist for the calcium sensing receptor (CaSR), activating CaSR in HEK-293 cells with an EC50 of 0.21 μM.</p>Fórmula:C11H17F3N2O7Cor e Forma:SolidPeso molecular:346.26Nastorazepide hemicalcium
CAS:<p>Nastorazepide (Z-360) hemicalcium is a selective, orally-administered 1,5-benzodiazepine derivative that functions as a receptor antagonist for gastrin/cholecystokinin 2 (CCK-2), exhibiting potential antitumor activity.</p>Fórmula:C29H36N4O5CaCor e Forma:SolidPeso molecular:540.66BMY-14802
CAS:<p>BMY-14802 (alpha-(4-fluorophenyl)-4-(5-fluoro-2-pyrimidinyl)-1-piperazine butanol) is a selective and orally active sigma-1 antagonist with an IC50 of 112 nM.</p>Fórmula:C18H22F2N4OPureza:99.84%Cor e Forma:SoildPeso molecular:348.39UCM 549
CAS:<p>UCM 549 is a bioactive chemical.</p>Fórmula:C19H21NO2Cor e Forma:SolidPeso molecular:295.38CAY10606
CAS:<p>CAY10606 has a wide range of applications in life science related research.</p>Fórmula:C22H18ClNO3Cor e Forma:SolidPeso molecular:379.84GRK2i
CAS:<p>GRK2 inhibitory polypeptide that specifically inhibits Gβγ activation of GRK2. Corresponds to the Gβγ-binding domain and acts as a cellular Gβγ antagonist.</p>Fórmula:C153H256N50O41SPureza:98%Cor e Forma:SolidPeso molecular:3484.08Satavaptan
CAS:<p>Satavaptan is a vasopressin V2 receptor antagonist. Satavaptan improves the control of ascites in cirrhosis.</p>Fórmula:C33H45N3O8SCor e Forma:SolidPeso molecular:643.79AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Fórmula:C30H33F7N2O6SCor e Forma:SolidPeso molecular:682.65A2A/A3 AR antagonist-1
<p>A2A/A3 AR antagonist-1 is a dual fluorescent AR ligand with K i of 90 nM (hA2A) & 31.8 nM (hA3).</p>Fórmula:C56H71N15O12S2Cor e Forma:SolidPeso molecular:1210.39Nebentan
CAS:<p>Nebentan (YM598) is an oral, selective ETA antagonist; Ki: 0.697 nM (ETA), 569 nM (ETB); may slow cor pulmonale, myocardial infarction.</p>Fórmula:C24H21N5O5SCor e Forma:SolidPeso molecular:491.52Lys-Bradykinin
CAS:<p>Endogenous bradykinin receptor agonist</p>Fórmula:C56H85N17O12Pureza:98%Cor e Forma:SolidPeso molecular:1188.38MLGFFQQPKPR-NH2
CAS:<p>MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide [1] .</p>Fórmula:C63H98N18O13SCor e Forma:SolidPeso molecular:1347.63Utreglutide
CAS:<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Fórmula:C191H298N46O58Cor e Forma:SolidPeso molecular:4166.67Urocortin II, human
Human urocortin (hUcn) II is a new member of the corticotropin-releasing-factor (CRF) family. It selectively binds to the CRF2 receptor.Fórmula:C194H339N63O54SPureza:98%Cor e Forma:SolidPeso molecular:4450.28MK-0493 HCl
CAS:<p>MK-0493 is a novel, potent, and selective agonist for melanocortin receptor 4 (MC4R).</p>Fórmula:C30H39Cl2F2N3O2Cor e Forma:SolidPeso molecular:582.55Preclamol hydrochloride
CAS:<p>Preclamol hydrochloride: selective dopamine agonist with research potential in schizophrenia.</p>Fórmula:C14H22ClNOCor e Forma:SolidPeso molecular:255.78PD 142893
CAS:<p>PD 142893 is a functional endothelin-stimulated vasoconstriction antagonist.</p>Fórmula:C50H65N7O10Pureza:98%Cor e Forma:SolidPeso molecular:924.09S1P2 antagonist 1
CAS:<p>S1P2 antagonist 1 is an orally bioavailable S1P2 antagonist against fibrotic diseases.</p>Fórmula:C23H21ClN4O4Cor e Forma:SolidPeso molecular:452.9Ala-parafluoroPhe-Arg-Cha-Cit-Tyr-NH2
CAS:<p>Ala-parafluoroPhe-Arg-Cha-Cit-Tyr-NH2 is a biologically active peptide functioning as a selective agonist for Protease Activated Receptor 1 (PAR-1), a subtype</p>Fórmula:C42H63FN12O8Cor e Forma:SolidPeso molecular:883.02DSP-1053
CAS:<p>Dsp-1053 is a powerful SERT (Ki=1.02 nM) inhibitor with partial 5-HT1A receptor (Ki=5.05 nM) agonizing activity.</p>Fórmula:C26H32BrNO4Pureza:98%Cor e Forma:SolidPeso molecular:502.44N-Desmethyl Pimavanserin
CAS:<p>N-Desmethyl Pimavanserin (AC-279) is the active metabolite of Pimavanserin and is used in the treatment of insomnia and other sleep disorders.</p>Fórmula:C24H32FN3O2Pureza:98.02%Cor e Forma:SolidPeso molecular:413.53L-770644
CAS:<p>L-770644 is an agonist of B3 adrenergic receptor.</p>Fórmula:C30H37N7O4SCor e Forma:SolidPeso molecular:591.72Hemopressin(human, mouse) TFA
CAS:<p>Hemopressin TFA: nonapeptide from hemoglobin, oral CB1 inverse agonist, eases inflammatory pain.</p>Fórmula:C52H80F3N13O14Pureza:98%Cor e Forma:SolidPeso molecular:1168.27SKF-83566 hydrochloride
CAS:<p>SKF-83566 hydrochloride is a D1-like dopamine receptor antagonist, inhibiting dopamine transporters and mitigating GBP-induced CPP.</p>Fórmula:C17H19BrClNOPureza:99.27%Cor e Forma:SoildPeso molecular:368.69LY83583
CAS:<p>LY83583 is a soluble guanylate cyclase competitive inhibitor with IC50 of 2 µM.</p>Fórmula:C15H10N2O2Pureza:99.54% - 99.80%Cor e Forma:SolidPeso molecular:250.25SphK1&2-IN-1
CAS:<p>SphK1&2-IN-1 is a sphingosine kinase inhibitor with anti-inflammatory, antitumor and hemostatic effects.</p>Fórmula:C14H14N2O3SPureza:99.59%Cor e Forma:SolidPeso molecular:290.34Paynantheine
CAS:<p>Paynantheine is an alkaloid with antinociceptive properties, found in Mitragyna speciosa. It also acts as an agonist at 5-HT1AR and 5-HT2BR receptors, inducing lower lip contraction and providing antinociception in rats.</p>Fórmula:C23H28N2O4Cor e Forma:SolidPeso molecular:396.48(R,R)-Palonosetron Hydrochloride
CAS:<p>(R,R)-Palonosetron Hydrochloride is the active enantiomer of Palonosetron</p>Fórmula:C19H25ClN2OPureza:98%Cor e Forma:SolidPeso molecular:332.87Clomipramine D3
CAS:<p>Clomipramine D3 is deuterium-labeled Clomipramine, blocking serotonin, norepinephrine, dopamine transporters (Ki: 0.14, 54, 3 nM).</p>Fórmula:C19H23ClN2Pureza:98%Cor e Forma:SolidPeso molecular:317.87Kisspeptin-10, rat
CAS:<p>Kisspeptin-10, rat is an Endogenous ligand for the rodent kisspeptin receptor (KISS1, GPR54).</p>Fórmula:C63H83N17O15Pureza:98%Cor e Forma:SolidPeso molecular:1318.44Adrenomedullin (AM) (22-52), human acetate
<p>Adrenomedullin (AM) (22-52), human acetate is an antagonist of calcitonin generelated peptide receptor in the hindlimb vascular bed of the cat and an</p>Fórmula:C161H256N46O50Pureza:99.42%Cor e Forma:SolidPeso molecular:3636.09Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Fórmula:C192H289N47O61Pureza:99.83%Cor e Forma:SolidPeso molecular:4229.0957ACTH (1-17)
CAS:<p>ACTH (1-17), a potent MC1 receptor agonist with a Ki of 0.21 nM, is a variant of corticotropin from the pituitary gland.</p>Fórmula:C95H145N29O23SPureza:98%Cor e Forma:SolidPeso molecular:2093.41TRV045
CAS:<p>TRV045 is a selective agonist of the sphingosine-1-phosphate (S1P) subtype 1 receptor and does not impact lymphocyte trafficking. It possesses antiepileptic properties.</p>Fórmula:C18H18N4O3Cor e Forma:SolidPeso molecular:338.36N6-Benzyl-5'-ethylcarboxamido adenosine
CAS:<p>N6-Benzyl-5'-ethylcarboxamido adenosine is a selective A3 adenosine receptor agonist.</p>Fórmula:C19H22N6O4Cor e Forma:SolidPeso molecular:398.42(Rac)-Norcisapride
CAS:<p>Norcisapride, a 5-HT3 and 5-HT4 agonist, treats GI, orofacial, and ENT disorders.</p>Fórmula:C14H20ClN3O3Pureza:99.32%Cor e Forma:SoildPeso molecular:313.78PSMA/GRPR ligand 1
<p>PSMA/GRPR ligand 1 (compound 3) is a bispecific ligand with dual targeting capabilities for tumors that express PSMA(+) and GRPR(+).</p>Cor e Forma:Odour SolidALEPH hydrochloride
CAS:<p>ALEPH (hydrochloride) acts as a partial agonist of h5-HT2A and h5-HT2B receptors, with EC50 values of 10.3 nM and 19.2 nM, respectively. It can induce head twitch responses in mice, with an ED50 of 0.80 mg/kg.</p>Fórmula:C12H20ClNO2SCor e Forma:SolidPeso molecular:277.814-Butyl-α-agarofuran
CAS:<p>4-Butyl-alpha-agarofuran, a Gharu-wood derivative, is an anxiolytic, antidepressant, and aids neurological research.</p>Fórmula:C18H30OCor e Forma:SolidPeso molecular:262.43Bamosiran
CAS:<p>Bamosiran, a small interfering RNA (siRNA), specifically targets the β-adrenergic receptor 2 to reduce intraocular pressure.</p>Cor e Forma:SolidBMS-193885
CAS:<p>BMS-193885 is a selective, brain-penetrant, and competitive antagonist of the neuropeptide Y1 receptor with a Ki of 3.3 nM, and an IC50 of 5.9 nM for hY1.</p>Fórmula:C33H42N4O6Pureza:99.73%Cor e Forma:SolidPeso molecular:590.71ECPLA
CAS:<p>ECPLA is an LSD analog and a potent 5-HT2A agonist (EC50 of 14.6 nM), capable of stimulating Gq-mediated calcium flux. It exhibits high affinity for most serotonin receptors, α2-adrenergic receptors, and D2-like dopamine receptors.</p>Fórmula:C21H25N3OCor e Forma:SolidPeso molecular:335.4417-phenyl trinor Prostaglandin F2α cyclopropyl methyl amide
CAS:<p>Prostaglandin F2α (PGF2α) activates the FP receptor, promoting smooth muscle contraction and luteolysis.</p>Fórmula:C27H39NO4Cor e Forma:SolidPeso molecular:441.612Terazosin dimer impurity dihydrochloride
CAS:<p>Terazosin dimer impurity dihydrochloride is a chemical byproduct of the α1-antagonist Terazosin, derived from quinazoline.</p>Fórmula:C24H30Cl2N8O4Cor e Forma:SolidPeso molecular:565.46rac Desmethyl Citalopram Hydrochloride
CAS:<p>rac Desmethyl Citalopram Hydrochloride is a 5-hydroxy tryptamine uptake inhibitor with IC50 value of 0.013 μM.</p>Fórmula:C19H20ClFN2OPureza:99.24%Cor e Forma:SolidPeso molecular:346.83Ethylpropyltryptamine
CAS:<p>Ethylpropyltryptamine (EPT) is an orally active novel psychoactive substance. It is predicted to act as a partial agonist of the 5-HT2A receptor.</p>Fórmula:C15H22N2Cor e Forma:SolidPeso molecular:230.35Metaterol
CAS:<p>Metaterol is a bioactive chemical.</p>Fórmula:C11H17NO2Cor e Forma:SolidPeso molecular:195.2582Adrenocorticotropic Hormone (ACTH) (4-10), human
CAS:<p>Adrenocorticotropic Hormone (ACTH) (4-10) is an agonist of potent melanocortin(MC4R) receptor .</p>Fórmula:C44H59N13O10SPureza:98%Cor e Forma:SolidPeso molecular:962.09G-Protein antagonist peptide acetate
<p>G-Protein antagonist peptide acetate is a truncated substance P-related peptide, competes with receptor for G protein binding.</p>Fórmula:C59H68N12O11SPureza:98.06%Cor e Forma:SolidPeso molecular:1153.33Metipranolol
CAS:<p>Metipranolol (Betamann) is a type of β- Adrenergic receptors（ β- A potent antagonist of adrenergic receptor on guinea pig atria β 1- Adrenergic receptors and rat uterus β The 2-adrenergic receptor exhibited the beta blocking potentials (pA2) of 8.3 and 8.4, respectively. It is also a potent substituent in the 3H DHA binding assay, with a ligand concentration of 0.7 nM and a Ki of 39 ± 24 nM.</p>Fórmula:C17H27NO4Pureza:98.37%Cor e Forma:SolidPeso molecular:309.4FR167344 free base
CAS:<p>FR167344 free base: oral, nonpeptide B2 bradykinin receptor antagonist, high-affinity (IC50: 65 nM), no B1 affinity.</p>Fórmula:C30H28BrCl2N5O4Pureza:98%Cor e Forma:SolidPeso molecular:673.38L-796,778 acetate
<p>L-796,778 acetate is a slective somatostatin receptor agonist with IC50 of 24nM for sst3, for sst1, sst2, sst4 and sst5, IC50 is >1000nM.</p>Fórmula:C31H44N6O9Pureza:98%Cor e Forma:SoildPeso molecular:644.72EB1002
CAS:<p>EB1002 is a selective NK2R agonist that has demonstrated significant enhancements in the expression levels of genes associated with mitochondrial biogenesis (such as PGC-1α) in obese mice. This suggests that EB1002 promotes energy expenditure by enhancing mitochondrial activity. Additionally, EB1002 has improved insulin sensitivity and glucose-lipid metabolism in mice. Therefore, EB1002 holds potential for research into obesity and type 2 diabetes.</p>Fórmula:C73H124N12O23Cor e Forma:SolidPeso molecular:1537.83Phoenixin-14 TFA
<p>Phoenixin-14 TFA (PNX-14 TFA) is an endogenous neuropeptide that can modulate GnRH receptor expression and exerts anxiolytic effects.</p>Fórmula:C75H110N18O20·xC2HF3O2Pureza:99.11%Cor e Forma:SolidPeso molecular:1583.78 (free base)Oxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Fórmula:C192H295N59O60SPureza:98%Cor e Forma:SolidPeso molecular:4421.86Boc-Phe-Leu-Phe-Leu-Phe
CAS:<p>Boc-Phe-Leu-Phe-Leu-Phe is a chemotactic peptide antagonist that inhibits the release of peptide leukotrienes induced by FMLP.</p>Fórmula:C44H59N5O8Cor e Forma:SolidPeso molecular:785.97SR-140603
CAS:<p>SR-140603, the less potent enantiomer of SR 140333, is used as the negative control.</p>Fórmula:C37H45Cl3N2O2Pureza:98%Cor e Forma:SolidPeso molecular:656.12Sar-[D-Phe8]-des-Arg9-Bradykinin
CAS:<p>Potent bradykinin B1 agonist, EC50 = 9.02 nM, enzyme resistant, induces hypotension and angiogenesis.</p>Fórmula:C47H66N12O11Pureza:98%Cor e Forma:SolidPeso molecular:975.11NTRC-824
CAS:<p>NTRC-824: NTS2 antagonist, 150x more selective than NTS1; IC50: 38 nM, Ki: 202 nM; nonpeptide, neurotensin-like.</p>Fórmula:C25H26F3N3O6SPureza:98%Cor e Forma:SolidPeso molecular:553.55Setmelanotide Acetate(920014-72-8 free base)
CAS:<p>Setmelanotide Acetate(920014-72-8 free base) (RM-493 Acetate) is a selective agonist of melanocortin 4 receptor (MC4R)(human and rat MC4R with EC50s of 0.27 nM</p>Fórmula:C51H72N18O11S2Pureza:99.71%Cor e Forma:SolidPeso molecular:1177.35LY-53857 free base
CAS:<p>LY-53857 free base is a bioactive chemical.</p>Fórmula:C23H32N2O3Cor e Forma:SolidPeso molecular:384.51Zoliprofen
CAS:<p>Zoliprofen: potent, oral NSAID with anti-inflammatory, antipyretic, analgesic effects. Exceeds ibuprofen's efficacy in rats and rabbits.</p>Fórmula:C12H11NO3SPureza:99.62%Cor e Forma:SolidPeso molecular:249.29Bradykinin (1-7)
CAS:<p>Bradykinin (1-7), an amino-truncated peptide derived from Bradykinin, is a metabolite formed through enzymatic cleavage by endopeptidase.</p>Fórmula:C35H52N10O9Pureza:98%Cor e Forma:White Lyophilized PowderPeso molecular:756.85SLB1122168 formic
<p>SLB1122168 is a potent inhibitor of Spns2-mediated sphingosine-1-phosphate (S1P) release, exhibiting an IC50 value of 94 nM [1].</p>Fórmula:C23H37N3O3Pureza:98%Cor e Forma:SolidPeso molecular:403.56GB-6
CAS:<p>GB-6, a short linear peptide that selectively binds to the gastrin releasing peptide receptor (GRPR), shows potential as a high-contrast imaging probe due to</p>Fórmula:C32H45N11O8Pureza:98%Cor e Forma:SolidPeso molecular:711.77γ1-MSH
CAS:<p>Endogenous melanocortin MC3 receptor agonist (pKi = 7.46) that displays ~ 40-fold selectivity over MC4.</p>Fórmula:C72H97N21O14SPureza:98%Cor e Forma:SolidPeso molecular:1512.76A6770
CAS:<p>A6770 inhibits S1P lyase, causing [3H]dhS1P build-up in IT-79MTNC3 cells (EC50 <0.01 μM); less effective with vitamin B6 (EC50 <100 μM).</p>Fórmula:C6H8N2O2Cor e Forma:SolidPeso molecular:140.142Conessine hydrobromide
CAS:<p>Conessine hydrobromide is a naturally occurring steroid alkaloid and has been used in traditional herbal medicine as a treatment for amoebic dysentery.</p>Fórmula:C24H41BrN2Cor e Forma:SolidPeso molecular:437.51MDL 29913
CAS:<p>NK2 tachykinin receptor selective antagonist.</p>Fórmula:C40H56N8O6Pureza:98%Cor e Forma:SolidPeso molecular:745H4R antagonist 3
CAS:<p>H4R antagonist 3 is a novel histamine-4 receptor (H4R) antagonist with an EC50 <10 mM.H4R antagonist 3 has potential inflammatory activity for the study of</p>Fórmula:C19H21ClN4SPureza:98%Cor e Forma:SolidPeso molecular:372.92G-Protein antagonist peptide
CAS:<p>Peptide inhibits G protein-receptor binding; competitively blocks M2 and β-adrenoceptor-induced Gs/Gi/Go activation.</p>Fórmula:C57H64N12O9SPureza:98%Cor e Forma:SolidPeso molecular:1093.27KSK67
CAS:<p>KSK67 is a selective dual antagonist of sigma-2 and histamine H3 receptors with inhibitory effects on H3 receptors, sigma-1, and sigma-2 receptors, with Ki</p>Fórmula:C22H27N3O2Pureza:99.11%Cor e Forma:SoildPeso molecular:365.47Leukotriene B4 Ethanolamide
CAS:<p>LTB4 binds to BLT1 (high affinity) and BLT2. LTB4-EA, a metabolite, is a stronger BLT1 antagonist, suggesting anti-inflammatory properties.</p>Fórmula:C22H37NO4Cor e Forma:SolidPeso molecular:379.541Bertilimumab
CAS:<p>Bertilimumab (CAT 213; iCo-008), a human monoclonal antibody that targets eotaxin-1 (CCL11), shows promise in the research of allergic disorders [1].</p>Cor e Forma:LiquidEcnoglutide
CAS:<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Fórmula:C194H304N48O61Cor e Forma:SolidPeso molecular:4284.76RXFP3/4 agonist 1
CAS:<p>RXFP3/4 agonist 1 is a relaxin family peptide 3/4 receptor (RXFP3/4) agonist(EC50s of 82/2 nM, respectivley).</p>Fórmula:C20H22ClN5OPureza:98%Cor e Forma:SolidPeso molecular:383.88[D-Trp8]-γ-MSH
CAS:<p>[D-Trp8]-γ-MSH is a selective melanocortin 3 (MC3) receptor agonist (IC50 values are 6.7, 340 and 600 nM for human MC3, MC5 and MC4 receptors respectively).</p>Fórmula:C74H99N21O16SPureza:98%Cor e Forma:SolidPeso molecular:1570.79(R)-Preclamol hydrochloride
CAS:<p>(R)-Preclamol HCl is a dopamine agonist stimulating both auto and postsynaptic receptors.</p>Fórmula:C14H22ClNOCor e Forma:SolidPeso molecular:255.78Galanin (1-16), mouse, porcine, rat TFA
<p>Galanin (1-16) agonizes hippocampal receptors; Kd 3 nM. Active on locus coeruleus neurons in mice, pigs, rats.</p>Fórmula:C80H117F3N20O23Pureza:98%Cor e Forma:SolidPeso molecular:1783.9Glucagon receptor antagonists-1
CAS:<p>Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.</p>Fórmula:C29H34FNO2Pureza:98%Cor e Forma:SolidPeso molecular:447.58Methapyrilene hydrochloride
CAS:<p>Methapyrilene hydrochloride is a biochemical.</p>Fórmula:C14H20ClN3SCor e Forma:Liquid Solution) 5 5 (Ntp 1992)Peso molecular:297.85Substance P (1-9)
CAS:<p>Substance P (1-9), a nonapeptide, slows its own inactivation and stimulates neurons.</p>Fórmula:C52H77N15O12Pureza:98%Cor e Forma:SolidPeso molecular:1104.26d[Leu4,Lys8]-VP
CAS:<p>Vasopressin V1B agonist; Ki: 0.16nM V1B, 64nM oxytocin; weak antidiuretic/vasopressor; minimal oxytocic action.</p>Fórmula:C47H67N11O11S2Pureza:98%Cor e Forma:SolidPeso molecular:1026.2Spiroglumide
CAS:<p>Spiroglumide, a CCKB-gastrin antagonist that inhibits dose-dependent pentagastrin-induced acid hypersecretion with an ID50 of 20.1 (8.67-46.4) mg / kg, could be</p>Fórmula:C21H26Cl2N2O4Pureza:98.34%Cor e Forma:SoildPeso molecular:441.35Galanin (1-29)(rat, mouse)
CAS:<p>Non-selective galanin agonist; Ki: GAL1-0.98, GAL2-1.48, GAL3-1.47 nM. Anticonvulsant, stops full seizures in rats.</p>Fórmula:C141H211N43O41Pureza:98%Cor e Forma:White Lyophilized PowderPeso molecular:3164.499ANQ-11125 TFA
<p>ANQ-11125 TFA is a motilin antagonist with a pKd of 8.24, inhibiting motilide contractions in rabbits.</p>Fórmula:C88H126F3N19O23Cor e Forma:SolidPeso molecular:1875.05Vicasinabin
CAS:<p>Vicasinabin: potent CB2 agonist; researches chronic pain, atherosclerosis, bone mass, neuroinflammation.</p>Fórmula:C15H22N10OCor e Forma:SolidPeso molecular:358.41Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Pureza:98.41%Cor e Forma:Odour SolidO-Desethyl Dapagliflozin
CAS:<p>O-Desethyl Dapagliflozin (Empagliflozin-4) is a SGLT2 inhibitor, IC50=33nM.</p>Fórmula:C19H21ClO6Pureza:98.33%Cor e Forma:SolidPeso molecular:380.82ELA-32(human)
CAS:<p>Potent apelin receptor agonist with IC50 = 0.27 nM; does not bind GPR15/GPR25. Boosts hESC self-renewal and angiogenesis.</p>Fórmula:C170H289N63O39S4Pureza:98%Cor e Forma:SolidPeso molecular:3967.8BIBP3226
CAS:<p>BIBP3226 is a potent and selective antagonist for the Neuropeptide Y receptor Y1 and the neuropeptide FF receptor.</p>Fórmula:C27H31N5O3Cor e Forma:SolidPeso molecular:473.57Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Fórmula:C148H224N40O45·xC2HF3O2Cor e Forma:Solid8-Chloro caffeine
CAS:<p>8-Chloro caffeine binds to adenosine receptors with a Ki of 30 µM. It enhances UV-induced chromosomal aberrations in the Cl-I type Chinese hamster embryo lung cells. 8-Chloro caffeine is a derivative of the methylxanthine alkaloid caffeine.</p>Fórmula:C8H9ClN4O2Cor e Forma:SolidPeso molecular:228.64Linzagolix choline
CAS:<p>Linzagolix choline is a GnRH antagonist. It can be used to study pain associated with uterine fibroids and endometriosis.</p>Fórmula:C27H28F3N3O8SPureza:99.64%Cor e Forma:SolidPeso molecular:611.59Methylhexanamine hydrochloride
CAS:<p>Methylhexanamine hydrochloride is a fatty amine and vasoconstrictor that functions as a nasal decongestant when inhaled through the nasal mucosa.</p>Fórmula:C7H18ClNCor e Forma:SolidPeso molecular:151.687-Methyl DMT
CAS:<p>7-Methyl DMT (7-TMT) acts as a 5-HT2 receptor agonist. Structurally, it is a tryptamine derivative and serves as an analytical reference for the psychoactive substance DOM. It is also applicable in research related to neurological disorders.</p>Fórmula:C13H18N2Cor e Forma:SolidPeso molecular:202.3L-797,591
CAS:<p>L-797,591 is a selective agonist of somatostatin receptor subtype 1.</p>Fórmula:C38H49N5O2Cor e Forma:SolidPeso molecular:607.83Esmolol acid hydrochloride
CAS:<p>Esmolol acid (ASL-8123) hydrochloride is a mild antagonist of β-adrenergic receptors. It inhibits the heart rate and diastolic pressure responses induced by Isoproterenol in a dose-dependent manner and is applicable for renal failure research.</p>Fórmula:C15H24ClNO4Cor e Forma:SolidPeso molecular:317.81CACPD2011a-0001278239
CAS:<p>CACPD2011a-0001278239 is a β2AR hybrid agonist with high affinity binding to both the wild-type and T164I β2AR variants. It exhibits neither cytotoxicity nor mutagenicity, making it suitable for asthma research.</p>Fórmula:C21H22N4O4Cor e Forma:SolidPeso molecular:394.42Sulfatroxazole
CAS:<p>Sulfatroxazole (Isosulfafurazole) (compound 12) is a selective antagonist of the ETA receptor with an IC50 of 0.26 μM.</p>Fórmula:C11H13N3O3SCor e Forma:SolidPeso molecular:267.3cAC 253 acetate
<p>cAC 253 acetate (TP2135 Free base) is an amylin antagonist. cAC 253 acetate inhibits 125I-adrenomedullin binding, with an IC50 of 25 nM.</p>Fórmula:C128H206N42O42S2Pureza:98.16% - 99.99%Cor e Forma:SoildPeso molecular:3069.39Prostaglandin D2 methyl ester
CAS:<p>PGD2: made in mast cells during allergic reactions, causes vasodilation and inhibits blood clots. PGD2 methyl ester is a similar, fat-soluble prodrug.</p>Fórmula:C21H34O5Cor e Forma:SolidPeso molecular:366.498Sufotidine
CAS:<p>Sufotidine (AH 25352X) is a highly selective competitive H2 receptor antagonist.</p>Fórmula:C20H31N5O3SPureza:99.03% - 99.92%Cor e Forma:SolidPeso molecular:421.564-Bromo-2,5-DMMA
CAS:<p>4-Bromo-2,5-DMMA (Compound 2) demonstrates affinity for the 5-HT2 binding site and has an ED50 of 0.82 mg/kg in rat discrimination experiments.</p>Fórmula:C12H18BrNO2Cor e Forma:SolidPeso molecular:288.18(3R,5R,6S)-Atogepant
<p>(3R,5R,6S)-Atogepant (MK-8031) is a CGRP antagonist enantiomer used in migraine research.</p>Fórmula:C29H23F6N5O3Cor e Forma:SolidPeso molecular:603.52Galanin-Like Peptide (human)
CAS:<p>Galanin-Like Peptide (human) is a neuropeptide consisting of 60 amino acids, instrumental in regulating feeding, body weight, and energy metabolism [1].</p>Fórmula:C292H451N83O84SPureza:98%Cor e Forma:SolidPeso molecular:6500.28Glucagon-like peptide 1 (1-37), human
CAS:<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Fórmula:C186H275N51O59Pureza:98%Cor e Forma:SolidPeso molecular:4169.48Des-Arg9-[Leu8]-Bradykinin acetate
CAS:<p>Des-Arg9-[Leu8]-Bradykinin acetate is a potent antagonist of the bradykinin receptor 1 (B1R), utilized in renal fibrosis research [1].</p>Fórmula:C43H67N11O12Pureza:98%Cor e Forma:SolidPeso molecular:930.06(-)-Eseroline fumarate
CAS:<p>(-)-Eseroline fumarate, a Physostigmine metabolite and AChE inhibitor, triggers cancer cell LDH release and neuronal cell death.</p>Fórmula:C17H22N2O5Cor e Forma:SolidPeso molecular:334.37(Leu31,Pro34)-Peptide YY (human) (TFA)
<p>"(Leu31,Pro34)-Peptide YY (human) (TFA) is the trifluoroacetic acid (TFA) form of (Leu31,Pro34)-Peptide YY (human), a derivative of Peptide YY that acts as a</p>Fórmula:C195H296N54O56·xC2HF3O2Pureza:98%Cor e Forma:SolidPeso molecular:4292.75 (free base)9-deoxy-9-methylene Prostaglandin E2
CAS:<p>9-deoxy-9-methylene PGE2: stable PGE2 analog with similar effects, less side effects, equal potency in rats, gerbils, primates.</p>Fórmula:C21H34O4Cor e Forma:SolidPeso molecular:350.499Galanin-Like Peptide (rat)
CAS:<p>Galanin-Like Peptide (rat), a neuropeptide comprising 60 amino acids, plays a crucial role in regulating feeding, body weight, and energy metabolism [1].</p>Fórmula:C288H461N87O83SPureza:98%Cor e Forma:SolidPeso molecular:6502.34P2Y14R antagonist 3
<p>P2Y14R antagonist 3 (compound A) is an orally active P2Y14R antagonist with an IC50 of 23.60 nM and a Kd of 7.26 μM. It mitigates lung injury in mice induced by Lipopolysaccharides (LPS) and can be utilized in the study of inflammatory diseases.</p>Fórmula:C26H25N5O5Cor e Forma:SolidPeso molecular:487.51CB2 PET Radioligand 1
<p>CB2 PET Radioligand 1 (compound [18F]9) is a positron emission tomography (PET) radioligand with high affinity for the human cannabinoid receptor 2 (hCB2, Ki=7.</p>Fórmula:C20H19F3N4OPureza:98%Cor e Forma:SolidPeso molecular:388.39MM 54
CAS:<p>Potent apelin receptor antagonist (Ki=82 nM, IC50=93 nM), counters [Pyr1]-Apelin-13, inhibits glioblastoma growth in mice.</p>Fórmula:C70H121N29O15S4Pureza:98%Cor e Forma:SolidPeso molecular:1737.15GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Fórmula:C151H230N40O47Pureza:99.89%Cor e Forma:SolidPeso molecular:3357.68[D-Phe12,Leu14]-Bombesin
CAS:<p>Bombesin receptor blocker; stops binding in rat brain (IC50=2 μM), hinders amylase release (IC50=4 μM), reduces appetite suppression in vivo.</p>Fórmula:C77H113F3N22O20Pureza:98%Cor e Forma:SolidPeso molecular:1724.9Neuropeptide W-30 (human)
CAS:<p>Neuropeptide W-30 (human) serves as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It acts as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8, binding and activating them at comparable effective doses [1] [2] [3].</p>Fórmula:C165H249N49O37SCor e Forma:SolidPeso molecular:3543.11Secretin (33-59), rat TFA
<p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates the secretin receptor, increasing pancreas secretion of bicarbonate, enzymes, and K+.</p>Fórmula:C131H217F3N42O44Cor e Forma:SolidPeso molecular:3141.37S1PR1 modulator 1
CAS:<p>S1PR1 modulator 1 is a selective inhibitor of S1PR1 with a pIC50 of 7.6.</p>Fórmula:C23H24N2O3SPureza:99.69%Cor e Forma:SolidPeso molecular:408.51Donetidine
CAS:<p>Donetidine is a histamine H2 receptor antagonist used to treat digestive disorders.</p>Fórmula:C20H25N5O3SPureza:99.32%Cor e Forma:SolidPeso molecular:415.51PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Cor e Forma:Odour SolidApadenoson TFA
<p>Apadenoson TFA is a potent adenosine A2A receptor (A2AR) agonist that can be used to improve survival in patients infected with SARS.</p>Fórmula:C25H31F3N6O8Pureza:98.08%Cor e Forma:SoildPeso molecular:600.55hNTS1R agonist-1
<p>Compound 10, an hNTS1R agonist-1, acts as a full agonist with a strong affinity for hNTS1R (K i: 6.9 nM), showing the ability to cross the blood-brain barrier (</p>Fórmula:C37H62N10O9Pureza:98%Cor e Forma:SolidPeso molecular:790.95K-(D-1-Nal)-FwLL-NH2 TFA
<p>K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.</p>Fórmula:C53H68F3N9O8Cor e Forma:SolidPeso molecular:1016.16GS-2278
CAS:<p>GS-2278 is an antagonist of LPAR1 (lysophosphatidic acid receptor 1) with potential applications in the study of idiopathic pulmonary fibrosis (IPF).</p>Fórmula:C22H16F5N9O3Cor e Forma:SolidPeso molecular:549.41Cortistatin-29 (rat) (trifluoroacetate salt)
CAS:<p>Cortistatin-29, similar to somatostatin-28, derives from preprocortistatin and binds to SST receptors 1-5 with varying IC50 values.</p>Fórmula:C161H240N46O41S2Cor e Forma:SolidPeso molecular:3540.09PACAP-related Peptide (rat) (trifluoroacetate salt)
<p>PRP, a 29-amino acid peptide in the secretin/glucagon family, is found in rat brain regions and reproductive tissues.</p>Cor e Forma:SolidTT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Fórmula:C50H47Cl2N3O6Pureza:98%Cor e Forma:SolidPeso molecular:856.83FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Cor e Forma:SolidPeso molecular:3692.15Tirzepatide
CAS:<p>Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.</p>Fórmula:C225H348N48O68Pureza:99.52% - 99.99%Cor e Forma:SolidPeso molecular:4813.45V-0219 hydrochloride
<p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>Fórmula:C20H26ClF3N4O2Pureza:99.97%Cor e Forma:SoildPeso molecular:446.89FR252384
CAS:<p>FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).</p>Fórmula:C18H17N3Pureza:98%Cor e Forma:SolidPeso molecular:275.35Neuropeptide W-30 (rat)
CAS:<p>Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].</p>Fórmula:C165H249N49O38SCor e Forma:SolidPeso molecular:3559.11Labradimil
CAS:<p>Labradimil, a bradykinin B2 agonist, boosts brain drug delivery and tumor survival rates.</p>Fórmula:C49H75N15O12SPureza:98%Cor e Forma:SolidPeso molecular:1098.29AG 045572
CAS:<p>AG 045572 is a potent GnRH receptor antagonist that inhibits the GnRH receptor in humans and rats with Ki values of 6.0 nM and 3.8 nM, respectively.AG 045572 is</p>Fórmula:C30H37NO5Pureza:99.96%Cor e Forma:SolidPeso molecular:491.62CCK (26-30) (sulfated)
CAS:<p>CCK (26-30) is a digestive and satiety-related peptide fragment inhibiting [125I]CCK-33 binding by 10% at 0.1 mM.</p>Fórmula:C33H41N7O12S2Cor e Forma:SolidPeso molecular:791.85Albenatide
CAS:<p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>Fórmula:C26H47N7O9SPureza:98%Cor e Forma:SolidPeso molecular:633.76AY 254
CAS:<p>AY 254: Potent PAR2 agonist, ERK1/2 activation (EC50=2 nM), limits caspase 3/8, aids HT29 cell healing, boosts IL-8.</p>Fórmula:C30H49N9O6Cor e Forma:SolidPeso molecular:631.779Kisspeptin-54(human) TFA
<p>Endogenous kisspeptin-54(human) TFA targets KISS1/GPR54 receptors; Ki: 1.81 nM (rat), 1.45 nM (human); inhibits metastasis, boosts gonadotropin.</p>Fórmula:C258H401N79O78·C2HF3O2Cor e Forma:SolidPeso molecular:5971.45PG-931 TFA
<p>PG-931 TFA, a potent MC4 receptor agonist (IC50 0.58 nM), excels in selectivity and helps reverse hemorrhagic shock in vivo.</p>Fórmula:C61H86F3N15O13Cor e Forma:SolidPeso molecular:1294.42PAMP-12 (unmodified) (TFA)
<p>PAMP-12 (unmodified) TFA, an endogenous peptide and potent MRGPRX2 (MrgX2) agonist (EC50=20-50 nM), induces hypotension by inhibiting catecholamine secretion</p>Fórmula:C79H119F3N24O17Cor e Forma:SolidPeso molecular:1733.94(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat)
CAS:<p>(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a corticotropin-releasing factor (CRF) antagonist known to counteract the inhibitory effects of IL-1a</p>Fórmula:C159H267N49O43Cor e Forma:SolidPeso molecular:3553.12KB-5492 FA
<p>KB-5492 FA is a selective sigma receptor inhibitor with antiulcerogenic effects.CAS 번호128-52-56-8</p>Fórmula:C24H32N2O8Pureza:98.12%Cor e Forma:SolidPeso molecular:476.52Cisapride hydrate
CAS:<p>Cisapride acts directly as a selective agonist of serotonin 5-HT4 receptor with IC50 value of 0.483 μM. And It also acts indirectly as a parasympathomimetic.</p>Fórmula:C23H31ClFN3O5Pureza:98%Cor e Forma:SolidPeso molecular:483.96HAEGTFTSDVS
CAS:<p>HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.</p>Fórmula:C48H71N13O20Pureza:98%Cor e Forma:SolidPeso molecular:1150.18Prepro-ANF (56-92), human
CAS:<p>Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.</p>Fórmula:C173H270N44O57Cor e Forma:SolidPeso molecular:3878.26Kisspeptin-10, human TFA
<p>"Kisspeptin-10, human TFA: vasoconstrictor, angiogenesis inhibitor, metastasis suppressor via GPR54, key in kidney development & osteoblast differentiation."</p>Fórmula:C63H83N17O14·C2HF3O2Cor e Forma:SolidPeso molecular:1416.46Glucagon (19-29), human
CAS:Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.Fórmula:C61H89N15O18SPureza:98%Cor e Forma:SolidPeso molecular:1352.53(Trp7,β-Ala8)-Neurokinin A (4-10)
CAS:<p>(Trp7,β-Ala8)-Neurokinin A (4-10) is a potent neurokinin-3 (NK3) antagonist [1] .</p>Fórmula:C41H57N9O10SCor e Forma:SolidPeso molecular:868.0112-epi Leukotriene B4
CAS:<p>LTB4 is made enzymatically (12(R)-specific) and non-enzymatically (6-trans-12-epi mix). 12-epi LTB4 has low receptor activity.</p>Fórmula:C20H32O4Cor e Forma:SolidPeso molecular:336.472BIIE-0246
CAS:<p>BIIE-0246 is a potent and highly selective non-peptide neuropeptide Y (NPY) Y2 receptor antagonist. With an IC50 of 15 nM.</p>Fórmula:C49H57N11O6Pureza:98%Cor e Forma:SolidPeso molecular:896.05AC 187 TFA
<p>AC 187 TFA, a potent and orally active amylin receptor antagonist, exhibits an IC50 of 0.48 nM and a Ki of 0.275 nM.</p>Fórmula:C129H206F3N37O42Cor e Forma:SolidPeso molecular:3004.27sGnRH-A
CAS:<p>sGnRH-A, a salmon GnRH analog, boosts growth hormone and induces ovulation for artificial insemination.</p>Fórmula:C64H83N17O12Cor e Forma:SolidPeso molecular:1282.45(Phe2,Orn8)-Oxytocin
CAS:<p>(Phe2,Orn8)-Oxytocin: Selective V1 agonist, induces rabbit epididymis contractility, EC50=280 nM.</p>Fórmula:C42H65N13O11S2Cor e Forma:SolidPeso molecular:992.18
![Sar-[D-Phe8]-des-Arg9-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1917.webp&w=3840&q=75)
![[D-Trp8]-γ-MSH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1893.webp&w=3840&q=75)
![d[Leu4,Lys8]-VP](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1927.webp&w=3840&q=75)
![Des-Arg9-[Leu8]-Bradykinin acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT80072.webp&w=3840&q=75)
![[D-Phe12,Leu14]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1916.webp&w=3840&q=75)
