Biochemicals and Reagents

BPAM-344 is a new class of agent that has been developed for the treatment of Alzheimer's disease. It has shown low toxicity and good pharmacokinetics in animal studies. BPAM-344 is an ionotropic glutamate receptor antagonist that prevents glutamate from binding to the receptor and activating it. This agent also has the ability to block or prevent the development of tolerance to low doses of x-ray radiation, which may be due to its ability to inhibit structural changes in DNA caused by radiation exposure. The structural analysis of this drug revealed a novel molecular scaffold that is different from other agents in its class. A fluorescence assay confirmed that BPAM-344 binds tightly with aluminum oxide, which may be used as a potential adjuvant for this drug.

Rabbit polyclonal UBD antibody

Vatalanib succinate is a small molecule drug that inhibits the activity of the vascular endothelial growth factor receptor (VEGFR). Vatalanib succinate binds to the VEGFR and prevents it from binding to its ligands, such as stem cell factor. It has been shown to inhibit metastatic colorectal cancer in animal models. Vatalanib succinate also has biological effects on other cancer cells, including HL-60 cells and mcf-7 cells. The combination of vatalanib succinate with other compounds, such as colony-stimulating factors or toll-like receptor antagonists, may have synergistic effects.

LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Purified Polyclonal ATF7 antibody

4-Hydroxy trimethoprim-d9 is a peptide that is used as a research tool to study protein interactions. It can be used as an inhibitor of ion channels and ligands for receptors. 4-Hydroxy trimethoprim-d9 has been shown to inhibit the interaction between the bacterial cobalamin receptor and the ligand cobalamin, which prevents bacteria from producing coenzyme B12. This inhibition leads to bacterial cell death due to lack of coenzyme B12 in the cells.

Rabbit polyclonal SGCG antibody

MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.

KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL

grafted copolymers consisting of a low crosslinked polystyrene matrix on which polyethylene glycol (PEG or POE) is grafted via an ethyl ether group which increases stability towards acid treatment and minimizes PEG-leaching. These copolymers are pressure stable.  They have high diffusion rates and excellent swelling in a wide range of solvents from e.g. toluene to water.   Can be used in a wide variety of applications such as acylations.

RN 9893 is a novel, non-peptide, orally available, small molecule that antagonizes the TGF-β1 receptor. This drug has been shown to inhibit cancer cell proliferation and tumor growth in vitro and in vivo. RN 9893 has also been shown to reduce microbial load in mice with disseminated candidiasis. Combination therapy with this compound was found to be more effective than monotherapy for the treatment of cancer cells. More research is needed before this drug can be used to treat human cancers.

Please enquire for more information about (+)-DHMEQ including the price, delivery time and more detailed product information at the technical inquiry form on this page

Murf1-in-1 is a peptide that is an activator of the TRPV1 receptor. It has been shown to inhibit the activity of protein kinase C and phospholipase C, and can be used as a research tool for studying the effects of TRPV1 activation on cell biology. Murf1-in-1 also binds to antibodies such as anti-murine TRPV1, which can be used in immunohistochemistry to detect murine TRPV1 expression.
TRPV1 is a ligand-gated ion channel that is activated by various substances, including capsaicin, protons and heat. Activation of the TRPV1 receptor leads to changes in membrane potential, cellular excitability and pain sensation.

4-Desmethyl istradefylline is a research tool that belongs to the group of ligands that bind to receptors. It has been shown to be an activator of Ligand-gated ion channels and inhibit the opening of potassium channels. 4-Desmethyl istradefylline has also been shown to have a high affinity for antibody and protein interactions. This ligand binds to receptor sites on cells, which leads to a change in the cell's physiology or functions. This compound has been shown to be an inhibitor of calcium ion channels, which may result in anti-inflammatory effects.

Pancreastatin is a peptide that has been shown to inhibit pancreatic cancer cell proliferation. Pancreastatin binds to the receptor for pancreatic polypeptide and inhibits the release of insulin, leading to inhibition of protein synthesis. This drug is also an activator of voltage-gated potassium channels, which are proteins that regulate the flow of positively charged potassium ions across the membranes of cells. Pancreatastatin is purified from porcine pancreas and has a purity greater than 95%.

MRTX-1257 is an inhibitor of protein tyrosine phosphatases, which are enzymes that dephosphorylate proteins on the surface of cells. MRTX-1257 is a covalent inhibitor that binds to the active site of these enzymes and prevents them from dephosphorylating specific proteins. This mechanism has been shown to have immunomodulatory effects in tumor tissue and to be effective against cancer. In addition, MRTX-1257 has been shown to inhibit pancreatic cancer growth in a mouse model. It also inhibits tumor cell proliferation by binding to cell receptors or altering their function.

PKI-166 is a mitochondria-targeted prodrug that has been shown to be cytotoxic in vitro and in vivo. It binds to the mitochondrial membrane and causes depolarization, which leads to apoptosis. PKI-166 has also been shown to inhibit tumor growth in a rat model of subcutaneous tumors. The drug is cell type specific and does not affect normal cells such as fetal bovine or mouse embryonic fibroblasts. PKI-166 is activated by dna binding activity and can bind to DNA as well as proteins such as epidermal growth factor (EGF) and tetrazolium dye. PKI-166 has pharmacokinetic properties that are different from other drugs in its class, which include a long half-life and low clearance rate. The drug also inhibits the proliferation of carcinoma cell lines with high epidermal growth factor receptor expression levels, but not with low EGF receptor expression levels.

CD152 antibody (FITC) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

CGS 9343B is a fatty acid that binds to calcium and calmodulin. It has been shown to have cytosolic calcium-dependent activity in skin cells, which may be due to its ability to induce the release of epidermal growth factor (EGF). CGS 9343B also inhibits atp levels and ATP-sensitive potassium channels in experimental models. This drug has been shown to inhibit the growth of diarrheal pathogens such as Clostridium difficile and Salmonella enterica.

(±)5(6)-DiHETE is an analog of the urine-derived metabolite 5-HETE, which has been shown to have potent anticancer properties. It functions as a kinase inhibitor, blocking the activity of kinases that are involved in cancer cell growth and survival. This compound has been extensively studied in Chinese hamster ovary cells and human tumor cell lines, where it has been shown to induce apoptosis (cell death) in cancer cells. Additionally, (±)5(6)-DiHETE has demonstrated medicinal potential as a protein kinase inhibitor, making it a promising candidate for the development of new anticancer drugs. Its ability to inhibit kinases may also make it useful in the treatment of other diseases that involve abnormal kinase activity.

CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.