Biochemicals and Reagents

<p>Peptide H-VLIVPQNFVVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>MRS 1845 is a synthetic compound, which serves as a potent and selective antagonist. This compound is derived from chemical synthesis techniques aimed at creating molecules that can interact with specific biological pathways. It functions by binding to calcium channels, thereby inhibiting the influx of calcium ions in target cells. This mode of action makes it valuable in elucidating the role of calcium channels in various physiological and pathological processes.</p>

<p>Acid Brown 85 is a reactive dye that is used to color paper, textiles and leather. It is an azo dye, which means it contains a benzene ring with two nitrogen atoms in the 1- and 2-positions. Acid Brown 85 is soluble in water and has good dispersibility. It can be used as an extender for other dyes or as a reactive dye for cellulose fibers. Acid Brown 85 may also be used as a pigment in paints and varnishes. The product has low energy reactivity, meaning it does not need to be heated before use.</p>

<p>Human recombinant monoclonal antibody targeting the F protein of respiratory syncytial virus (RSV)</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.</p>

<p>Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.</p>

<p>MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.</p>

<p>MERS-CoV Spike Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about MERS-CoV Spike Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-AWW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>EBNA IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBNA IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Ala-AMC is a fluorescent peptide that binds to the receptor AMPA and activates it. This product is used in research as a tool for studying protein interactions, cellular biology and pharmacology.</p>

<p>MOCAc-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg is a peptide that is used as an activator and inhibitor of ion channels. This peptide has been shown to be a potent inhibitor of the voltage dependent Na+ channel, which is responsible for the depolarization of nerve and muscle cells. MOCAc has also been shown to bind with high affinity to the NMDAR receptor in a competitive manner. The binding of this peptide to the NMDAR receptor prevents glutamate from binding, which leads to inhibition of downstream signaling pathways such as NMDA receptor activation and intracellular calcium release.</p>

<p>VIP Antagonist is a drug that inhibits the α7 nicotinic acetylcholine receptor and has been shown to have inhibitory properties against cancer tissues. The drug blocks the response element for VIP, inhibiting cyclase activity. This prevents the production of VIP and other neuropeptides, which are involved in nerve cell growth and survival. VIP Antagonist also inhibits toll-like receptor signaling pathways by blocking TLR2 and TLR4, which are receptors on immune cells that recognize bacterial products. In addition, this drug binds to human immunoglobulin G (IgG) and prevents it from binding to its Fc receptor on immune cells, thus preventing IgG-mediated complement activation or antibody-dependent cellular cytotoxicity.</p>

<p>SARS-CoV-2/Flu A/Flu B/RSV Negative Human Nasal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2/Flu A/Flu B/RSV Negative Human Nasal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Human monoclonal antibody; inhibits granulocyte-macrophage colony-stimulating factor (GM-CSF)</p>

<p>Acetylcholinesterase inhibitor; therapy for Alzheimer's disease</p>

<p>IgG1 humanized monoclonal antibody targeting human HGFR</p>

<p>This is a monoclonal antibody that binds to the alpha-integrin receptor. The alpha-integrin receptor is an integrin that is involved in cell adhesion and migration, as well as the activation of several signaling pathways. This antibody has been shown to inhibit the binding of alpha-integrins to phospholipid membranes, which may be due to inhibition of protein kinase C (PKC). This antibody also inhibits thrombin receptor activation and dextran sulfate-induced cytosolic calcium mobilization.</p>

<p>Peptide H-YLAEVAAGDDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclin D1 is a key regulator of cell proliferation and its expression and accumulation within cells is under tight control. Cyclin D1 is the regulatory subunit of cyclin-dependent kinases 4 and 6. These activated cyclin dependent kinases then phosphorylate the retinoblastoma protein (Rb) and drive G1 to S phase progression. Cyclin D1 promotes cell proliferation through interaction with transcription factors such as the oestrogen receptor and specificity protein 1 (Sp1). Cell proliferation is extremely sensitive to altered levels of cyclin D1, with even modest changes in its expression having noticeable effects on cell cycle progression. Cyclin D1 is a proto-oncogene and its overexpression is one of the most frequent alterations seen in multiple cancer types._x000D_<br>_x000D_<br>This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.</p>

<p>Peptide H-NIQSLEVIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-YLLPAIVHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YLLPAIVHI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YLLPAIVHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YLLPAIVHI-OH at the technical inquiry form on this page</p>

<p>Purified recombinant GARS/GlyRS protein (His tag)</p>

<p>H-LTGLSEISQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LTGLSEISQR-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LTGLSEISQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LTGLSEISQR-OH at the technical inquiry form on this page</p>

<p>Neuropathy Antibody Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neuropathy Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>CMV IgM (IgG Low Avidity) Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CMV IgM (IgG Low Avidity) Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Mal-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>

<p>Peptide H-ETPAATEAPSSTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Neisseria Gonorrhoeae Positive Urine is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neisseria Gonorrhoeae Positive Urine including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Human anti-VEGFR2 monoclonal antibody; antiangiogenic activity</p>

<p>LGD 3303 is an investigational selective androgen receptor modulator (SARM), which is a compound designed to selectively interact with androgen receptors in the body. SARMs like LGD 3303 are researched for their potential to mimic anabolic activity with reduced androgenic effects compared to traditional anabolic steroids. LGD 3303 acts by binding to androgen receptors, and it is believed to promote muscle growth and bone health without significantly affecting other tissues.</p>

<p>H-GGVGPFSDPVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGVGPFSDPVK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGVGPFSDPVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGVGPFSDPVK-OH at the technical inquiry form on this page</p>

<p>Ac-PFDLFIRKSPTITC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-PFDLFIRKSPTITC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-PFDLFIRKSPTITC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-PFDLFIRKSPTITC-NH2 at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-PEPAKSAPAPKKGSKKAVTKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VPTTAASTPDAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Guinea pig polyclonal Insulin antibody (Prediluted for IHC)</p>

<p>Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on the metaphase, meiosis, and gamete cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) is a cilengitide, which are small molecules that bind to calcium ions and increase intracellular levels of calcium. This leads to the activation of biochemical pathways in cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) has been shown to have a diacylglycerol antagonist effect in porcine oocytes and was used in clinical trials for the treatment of infertility. Cyclo(Arg-Ala-Asp-D-Phe Val) also has apoptotic activity in cancer cells.</p>

<p>HTLV-2 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HTLV-2 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Type 1 Diabetes/Stiff Person Syndrome Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Type 1 Diabetes/Stiff Person Syndrome Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>A recombinant human monoclonal antibody against heat-shock protein 90 (HSP90).</p>

<p>A bispecific monoclonal antibody CD20-directed CD3 T-cell engager.</p>

<p>Purified native Mouse IgG</p>

<p>EDDnp is a potent and selective inhibitor of the proteolytic enzyme dipeptidyl peptidase IV (DPP-IV). EDDnp binds to the active site of DPP-IV, which prevents it from cleaving peptides at the carboxy terminus. The inhibition of DPP-IV results in an increase of peptide hormones such as glucagon-like peptide 1 (GLP-1) and gastric inhibitory polypeptide (GIP), which are involved in regulating blood glucose levels. In addition, there are high values of EDDnp in human serum and urine, which may be due to its function as a potential biomarker for diabetes. The physiological function of EDDnp is still being investigated.</p>

<p>H-YVVLDLPQETLEEETC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YVVLDLPQETLEEETC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YVVLDLPQETLEEETC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YVVLDLPQETLEEETC-OH at the technical inquiry form on this page</p>

<p>Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.</p>

<p>Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HBsAg ay Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBsAg ay Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-YIDIPELVANVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-K^AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A human IgG1κ anti-influenza B virus antibody.</p>

<p>H-SIETNFLDR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIETNFLDR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIETNFLDR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIETNFLDR-OH at the technical inquiry form on this page</p>

<p>Fluoxetine is a selective serotonin reuptake inhibitor (SSRI) that is used in the treatment of depression, obsessive-compulsive disorder, and other disorders. It is also used to reduce the symptoms of premenstrual dysphoric disorder. Fluoxetine inhibits the reabsorption of serotonin by neurons, which increases the levels of this neurotransmitter in the synaptic space.</p>

<p>Peptide Biot-YARAAARQARA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-Human GDF15 Monoclonal Antibody</p>

<p>Conjugated Benzoylecgonine-BSA hapten</p>

<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>

<p>Anti- human cd80 monoclonal IgG1 antibody</p>

<p>Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Humanized monoclonal antibody targeting E. coli Shiga-like toxin II B subunit</p>

<p>PML/SP100/AMA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about PML/SP100/AMA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>PR3 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about PR3 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Mycoplasma Pneumoniae is a common cause of respiratory illnesses, particularly in children and young adults, and the antigen serves as a crucial component in clinical testing for these infections. By enabling early and accurate detection, it guides appropriate therapeutic interventions and contributes to a better understanding of the epidemiology of Mycoplasma infections. Its application is vital in both clinical settings and research laboratories focused on infectious disease diagnostics and pathogen study.For the preparation of the native antigen, Mycoplasma pneumoniae strain FH is propagated in a defined broth culture system. Following cultivation, the bacterial biomass undergoes detergent-mediated lysis to selectively enrich for the P1-adhesin component, yielding a purified antigenic preparation.Mycoplasma Pneumoniae Antigen is an antigen for use in IVD applications. Please enquire for more information about Mycoplasma Pneumoniae Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Ac-RRNELKRSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RRNELKRSFFALRDQI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RRNELKRSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RRNELKRSFFALRDQI-OH at the technical inquiry form on this page</p>

<p>ASMA/Actin/F-Actin Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ASMA/Actin/F-Actin Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Ac-CAGQFILGDRPSKILS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CAGQFILGDRPSKILS-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CAGQFILGDRPSKILS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CAGQFILGDRPSKILS-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Drotaverine is an antispasmodic drug that is used to alleviate gastrointestinal and genitourinary smooth muscle spasms. This drug works by inhibiting phosphodiesterase-4 and increasing levels of cAMP leading to smooth muscle relaxation.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Defibrinated Human Serum is a valuable resource in the field of Life Sciences. It contains various inhibitory factors, potassium, and antibodies that make it suitable for a wide range of assays. This product is commonly used in Biospecimens, Serum, Plasma &amp; Other Fluids, as well as Lysates &amp; Controls.</p>

<p>Humanized monoclonal antibody targeting CD200; for use in oncology</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Anti-CD4 humanized antibody; immunomodulator</p>

<p>H-TMDGNPGEL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TMDGNPGEL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TMDGNPGEL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TMDGNPGEL-OH at the technical inquiry form on this page</p>

<p>GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA</p>

<p>Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>RF Ig Total Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about RF Ig Total Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>D-dimer, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about D-dimer, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The Nanog antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Nanog, a key transcription factor involved in maintaining pluripotency and self-renewal of embryonic stem cells. This antibody has been extensively studied and validated for its high specificity and sensitivity in various applications such as immunofluorescence, immunohistochemistry, and Western blotting.</p>

<p>Cerivastatin is a drug that belongs to the class of drugs called statins. This drug is used to reduce the risk of cardiovascular events and lower lipid levels. Cerivastatin is an HMG-CoA reductase inhibitor and allows for a decrease in cholesterol in hepatic cells. Cerivastatin is cardioprotective and anti-atherosclerotic.</p>

<p>Mycoplasma Pneumoniae IgG Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Mycoplasma Pneumoniae IgG Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Toxocara Canis IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Toxocara Canis IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-VGTEDIPSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VGTEDIPSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VGTEDIPSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VGTEDIPSK-OH at the technical inquiry form on this page</p>

<p>A humanized monoclonal antibody that targets the N-terminal epitope of Notch ligand DLL4 (delta-like 4).</p>

<p>H-TYFQAKIRALKGSC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TYFQAKIRALKGSC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TYFQAKIRALKGSC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TYFQAKIRALKGSC-OH at the technical inquiry form on this page</p>

<p>Bremelanotide is a 7 amino acid peptide that is used to treat hypoactive sexual desire disorder in premenopausal women. This drug is an agonist of many melanocortin receptors. Although, its mechanism is unknown, it is said to increase melanin expression which aids in the regulation of sexual arousal.</p>

<p>Adenovirus antibody was raised in goat using hexon from ADV, type 2 as the immunogen.</p>

<p>HAMA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HAMA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-LAPYLFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAPYLFT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAPYLFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAPYLFT-OH at the technical inquiry form on this page</p>

<p>Goat anti-human IgM is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Goat anti-human IgM including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-CRPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Neutrophil Gelatinase-Associated Lipocalin (NGAL), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Canrenone is a steroidal antimineralcorticoid that is used as a diuretic. It has been shown to reduce blood pressure and increase urine volume. Also, this drug has shown to be effective in treating hirsutism in women.</p>

<p>H-LFESGDQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LFESGDQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LFESGDQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LFESGDQK-OH at the technical inquiry form on this page</p>