Carboxylic Acids

<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>

<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>

<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>

<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>

<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>H-Leu-Trp-Met-Arg-Phe-OH acetate salt is a molecule that transports amino acids across the cell membrane of bacteria, preventing bacterial growth. It is produced by proctolin and functional groups in dental plaque. This compound has been shown to inhibit the growth of bacteria in vitro by binding to hypochlorous acid, which is part of the antimicrobial activity of human neutrophils. H-Leu-Trp-Met-Arg-Phe-OH acetate salt has been used as a tracer for studying amino acid transport in E. coli cells and its uptake into extracellular vesicles. The product can also be used as an antiplaque agent due to its ability to inhibit the acid transport system and uptake of amino acids from the environment.</p>

<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>16-Mercaptohexadecanoic acid (16MHDA) is a fatty acid that has been shown to be an effective inhibitor of the enzyme fatty acid synthase. This enzyme is responsible for the synthesis of long-chain polyunsaturated fatty acids and their derivatives, which are key components of cell membranes and also act as signaling molecules. 16MHDA can be used in the treatment of diseases such as psoriasis, rheumatoid arthritis, and cancer. 16MHDA has been shown to have a high detection sensitivity and activity index when used in electrochemical impedance spectroscopy experiments. The x-ray diffraction data show that 16MHDA forms an acid complex with its substrate, which is thought to be the reaction mechanism. Colloidal gold has been used to study the interaction between 16MHDA and DNA duplexes. This compound was also found to have monoclonal antibody binding properties in human serum samples.</p>

<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>

<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>

<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>

<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>

<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>

<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>

<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>

<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>

<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>

<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>

<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>

<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Pyridineboronic acid is an antimicrobial agent that is used to treat bacterial and fungal infections. 3-Pyridineboronic acid is a prodrug that is metabolized to its active form, pyridinium boronate. This drug has been shown to be effective in the treatment of hypoxic tumors in mice, which are resistant to other anticancer drugs. 3-Pyridineboronic acid also has acidic properties and can be used as an antiseptic for the treatment of skin and eye infections. It can also be used as a hydrogen bonding partner when combined with halides, such as chloride or bromide ions. The drug binds to human serum proteins and forms an acidic complex that prevents bacterial growth by inhibiting protein synthesis. 3-Pyridineboronic acid also inhibits prostate cancer cells by competitively inhibiting the enzyme 4-pyridinylboronic acid reductase (4PBAR).</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>

<p>Please enquire for more information about (Des-acetyl)-a-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about s-2-(4-Aminobenyl)-diethylenetriamine penta-tert-butyl acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>