Carboxylic Acids

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>

<p>Please enquire for more information about Angiotensin (1-12) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>

<p>N-Methyliminodiacetic acid is a monosodium salt that is produced by the reaction of methylamine and malonic acid. It has been shown to have an inhibitory effect on enzymes and metabolic rates in the human body. The structure of N-methyliminodiacetic acid contains a hydroxyl group, which can form hydrogen bonding interactions with nitrogen atoms in proteins, forming a chelate ligand. This type of binding is thought to be responsible for its ability to inhibit enzyme activities and metabolic rate.</p>

<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-(2-Cyanopropan-2-yl)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>

<p>Please enquire for more information about pTH (2-34) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Please enquire for more information about H-D-Leu-Thr-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Ozarelix acetate salt is a synthetic androgen that has been shown to have pharmacological activity in the treatment of prostate cancer. It binds to albumin, which is found in high concentrations in the prostate, and is then released slowly over time. In rat studies, it has been shown to improve symptoms of depression by binding to serotonin receptors. This drug also binds with fatty acids in blood plasma and can be used as a biomarker for the presence of cancer. Ozarelix acetate salt has not been studied extensively in humans, but has shown promising results when used for the treatment of diabetic neuropathy and for cancer prevention.</p>

<p>Mevalonic acid lactone is a natural compound that has been shown to have an effect on mitochondrial membrane potential. It has also been shown to inhibit the drug transporter P-glycoprotein, which is involved in the transport of drugs out of cells. Mevalonic acid lactone has also demonstrated an anti-inflammatory effect, as it inhibits the production of TNF-α and IL-6 in human serum. This compound also possesses antioxidant properties, which may be due to its hydroxyl group and phenoxy groups. Mevalonic acid lactone can be used as a model system for sesquiterpene lactones, and it is able to improve mitochondrial functions by inhibiting pyrazole ring formation.</p>

<p>Docosahexaenoic acid (DHA) is a fatty acid that is usually obtained from fish oil. DHA has been shown to decrease the production of prostaglandin E2 (PGE2), which can lead to inflammation in various parts of the body. The synthesis and release of PGE2 is regulated by toll-like receptor 4 (TLR4). DHA has also been shown to reduce tumor size and improve survival rates in mice with breast cancer. DHA is a long-chain polyunsaturated fatty acid that can be found in many types of cells, including neurons. It has been shown to have beneficial effects on neuronal death during experimental models of stroke and traumatic brain injury.</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-alpha-Boc-Nbeta-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dibenzoyl-D-(+)-tartaric acid monohydrate is a weak organic acid that can be used as a neutralizing agent. It has been shown to react with hydrochloric acid, calcium carbonate, and other inorganic acids to form water soluble salts. This compound is also useful for the separation of enantiomers in chromatography and for the determination of the rate of reaction between an organic molecule and an inorganic acid. Dibenzoyl-D-(+)-tartaric acid monohydrate has been used as a template molecule for determining thermodynamic data on various molecules.</p>

<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>

<p>Mercuric acetate is a salt of mercuric and acetic acid. It is used as an antiseptic, disinfectant, and preservative in the food industry. Mercuric acetate has been shown to have anti-inflammatory properties and is used for the treatment of inflammatory bowel disease. The ester linkage between the two molecules allows it to be hydrolysed into its components by enzymes such as esterases or glucuronidases, which may be one of the reasons for its therapeutic effects. Mercuric acetate also reacts with biological molecules, including proteins, nucleic acids, and carbohydrates. This reaction mechanism may contribute to its other biological properties such as lowering blood sugar levels and inhibiting glycolysis in cells that depend on sodium-dependent glucose transport mechanisms.</p>

<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polymer of glutamic acid</p>

<p>Please enquire for more information about (Des-Pyr 1,Des-Gly10,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>

<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>

<p>H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.</p>

<p>Please enquire for more information about Amyloid beta-Protein (25-35) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>

<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PYX-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>

<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>Please enquire for more information about Boc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>

<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>

<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>

<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Amino-3-fluorobenzoic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>

<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>

<p>Thymalfasin is a peptide that belongs to the thymosin family. It is a biocompatible polymer with a number of biomedical applications, including as a component in wound dressings and anti-adhesive agents. Thymalfasin has been shown to be effective at inhibiting the replication of influenza A virus, which may be due to its ability to bind to toll-like receptor 4 (TLR4). This drug also has antitumor properties and has been shown to stimulate the production of IL-2 receptor in human monocytes. Thymalfasin also inhibits the growth of cancer cells, such as HL60 cells, by blocking DNA synthesis. The molecular weight of this compound is approximately 20-30 kDa.</p>

<p>L(+)-2,3-Diaminopropionic acid HCl is a chiral modifier that is used in the separation of organic compounds. It has been shown to selectively interact with borate, sulfate, and hydroxyapatite. This interaction changes the physical properties of these substances by modifying their surface charge or adsorption capacity. L(+)-2,3-Diaminopropionic acid HCl has also been shown to be useful in diastereoselective reactions. The technique of elution can be used to isolate specific compounds from mixtures using this compound as a modifier. Hydrogen bonding groups and moieties on the functional group are important factors in the specificity of this interaction.END&gt;&gt;</p>

<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>

<p>Please enquire for more information about MCLV3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Please enquire for more information about (Arg8)-Vasopressin (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A is a peptide that belongs to the class of opioid peptides. It acts as a kappa-opioid receptor agonist and is involved in the transmission of pain signals and other information from the central nervous system to the peripheral nervous system. Dynorphin A has been shown to inhibit the release of neurotransmitters, such as acetylcholine, dopamine, serotonin, and norepinephrine. It also blocks the action of transmitters at postsynaptic membranes by binding to their receptors. Dynorphin A binds with high affinity to kappa-opioid receptors and can be used for treatment of heroin addiction and chronic pain.</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chromone-2-carboxylic acid is a hydrochloric acid analog that is a prodrug for the formation of the active metabolite chromone-2,4-dihydroxybenzoic acid. Chromone-2-carboxylic acid has been shown to have anti-inflammatory properties in vitro and in vivo. It has also been shown to inhibit leukotriene synthesis by blocking the binding of LTC4 to its receptor.</p>