Carboxylic Acids

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>

<p>2-(4-Chlorophenyl-acetyl)benzoic acid is a fine chemical that is a versatile building block and useful intermediate. 2-(4-Chlorophenyl-acetyl)benzoic acid is used in the manufacture of other chemicals, such as pharmaceuticals, pesticides, dyes, or perfumes. It is also used for research purposes and as a reagent. It has a CAS number of 53242-76-5.</p>

<p>5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>

<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.</p>

<p>Amide; Trifluoroacetate salt</p>

<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>

<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>

<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>

<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>

<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>

<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>

<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>

<p>Please enquire for more information about H-Glu-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>

<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>