Carboxylic Acids

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt is a peptidomimetic with peroxidase activity. It has the ability to bind to red blood cells and monoclonal antibodies, which are used in spatially specific immunoassays. Fibronectin CS-1 Fragment (1978-1985) trifluoroacetate salt H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH trifluoroacetate salt also has an effect on hyperresponsiveness and can be used as a costimulatory antigen for cancer immunotherapy.</p>

<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.</p>

<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>

<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>

3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.

<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>

<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>

<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>

<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>

<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>3-Chloroquinoxaline-2-carboxylic acid is a synthetic compound that has been shown to have antimicrobial properties against bacteria. It is a quinoxaline derivative, which is an important class of compounds for the development of new antibiotics. 3-Chloroquinoxaline-2-carboxylic acid has been shown to inhibit bacterial growth through different mechanisms including blocking DNA synthesis, binding to RNA polymerase, and inhibiting protein synthesis. It also has been shown to be effective against drug resistant bacteria such as methicillin resistant Staphylococcus aureus (MRSA).</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>

<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>

<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>

<p>C3-Ethylbenzoic acid is an organic compound that can be synthesized from the reactants ethyl bromide, propylene oxide, and acetic anhydride. The synthesis of C3-Ethylbenzoic acid is a stepwise process in which the starting materials are converted to intermediates and then reacted to form the desired product. The reaction mechanism involves bond cleavage, which generates a carboxylic acid group on one end of the molecule and a phenyl group on the other end. C3-Ethylbenzoic acid interacts with clausamine and isoprene during transport through cell membranes. This interaction may lead to increased permeability of cell membranes by c3-ethylbenzoic acid.</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid is a potential drug for hypercholesterolemia. It has been shown to lower LDL cholesterol and triglycerides levels in monkeys. The compound is orally bioavailable and can be taken orally. This drug also has the potential to be developed as a PCSK9 (proprotein convertase subtilisin/kexin type 9) inhibitor.</p>

<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>

<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>