
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Secretin (porcine) acetate salt
CAS:Controlled Product<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Formula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/molTert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate
CAS:<p>Please enquire for more information about Tert-Butyl Trans-4-(2-Oxoethyl)Cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO3Purity:Min. 95%Molecular weight:241.33 g/molH-Lys-Lys-bNA acetate salt
CAS:<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O2Purity:Min. 95%Molecular weight:399.53 g/mol(Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C226H338N60O64SPurity:Min. 95%Molecular weight:4,951.53 g/molLHRH (1-2) (free acid) acetate salt
CAS:<p>LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is an analog of the natural hormone LHRH. It is a member of the amide category and has been shown to have a constant level in human serum. LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is resistant to renal proximal tubule uptake and has an acidic pH optimum, which inhibits its uptake into cells. This drug also has an inhibitory effect on the reaction products of hydrogen chloride and proximal tubules.</p>Formula:C11H14N4O4Purity:Min. 95%Molecular weight:266.25 g/mol2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt
CAS:<p>2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt (2HMP) is a diagnostic agent that can be used for the detection of bacterial infections. The conformational properties of 2HMP are similar to those of ATP, which allows it to bind to the polymerase chain reaction enzyme and initiate an enzymatic reaction. This leads to the production of a signal that can be detected by spectrophotometry or fluorometry. 2HMP has also been shown to have chemokine activity in vitro, but this has not been tested in vivo. 2HMP is a competitive inhibitor of human protein serine proteases, such as trypsin and chymotrypsin, with an IC50 value of approximately 1 μM.</p>Formula:C3H7NaO4S2Purity:Min. 95%Molecular weight:194.2 g/molHydrazine acetate
CAS:Controlled Product<p>Hydrazine acetate is an organic solution that has a glycoconjugate. It is also found in uridine, hydrogen bond and serine protease. Hydrazine acetate has been shown to have a benzyl group and carbonyl group. Hydrazine acetate interacts with trifluoroacetic acid and particle. This drug can be used for the treatment of autoimmune diseases, such as rheumatoid arthritis, and infectious diseases such as HIV/AIDS. Hydrazine acetate has shown high values for growth factor activity, which may be due to its ability to inhibit the enzyme ns3 protease in the synthesis of proinflammatory cytokines.</p>Formula:C2H4O2·H4N2Purity:Min. 95%Color and Shape:White PowderMolecular weight:92.1 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H285N55O57SPurity:Min. 95%Molecular weight:4,271.69 g/molH-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molExendin-4 (1-8) trifluoroacetate salt
CAS:<p>Please enquire for more information about Exendin-4 (1-8) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N11O13Purity:Min. 95%Molecular weight:833.85 g/molNorbornane-2exo,3exo-dicarboxylic acid-anhydride
CAS:<p>Norbornane-2exo,3exo-dicarboxylic acid-anhydride is a versatile building block that can be used as a reagent and speciality chemical. It also has the potential to be a useful intermediate for the synthesis of complex compounds and research chemicals. Norbornane-2exo,3exo-dicarboxylic acid-anhydride is a high quality compound with a CAS number of 14166-28-0.</p>Formula:C9H10O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:166.17 g/mol(Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molAc-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N6O11SPurity:Min. 95%Molecular weight:851.06 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/mol(±)7-epiJasmonic acid
CAS:<p>(±)7-EpiJasmonic acid is a carotenoid ester that has been found to have biological properties for weed control. It is the methyl ester of jasmonic acid, which is a fatty acid. The compound has been shown to be effective in suppressing plant diseases such as powdery mildew. The chemical transformation of (±)7-epiJasmonic acid can occur through methylation, hydroxylation, or nitro group formation. This process leads to the production of methyl jasmonate and nitrophenol. These compounds have been shown to have fertility effects on lettuce plants by increasing the number of seeds and seedlings produced.</p>Formula:C12H18O3Purity:Min. 95%Molecular weight:210.27 g/molEthyl 2-(2-chloroethoxy)acetate
CAS:<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11ClO3Purity:Min. 95%Molecular weight:166.6 g/molTAT 2-4 trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C132H240N66O29Purity:Min. 95%Molecular weight:3,215.75 g/mol5-Bromo-2-fluorobenzoic acid
CAS:<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>Formula:C7H4BrFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:219.01 g/molObestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N32O33Purity:Min. 95%Molecular weight:2,546.83 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H33BN2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:388.31 g/molMercaptoacetic acid sodium salt
CAS:<p>Mercaptoacetic acid sodium salt (MAS) is an oxidation catalyst that is used to convert ethyl alcohol into acetic acid. It has been shown to be a good catalyst for the oxidation of hydroxyl groups in the presence of metal hydroxides or inorganic acids, such as sodium carbonate. MAS has also been shown to be toxic to human serum and is not recommended for use in humans. The toxicity of MAS may be due to its ability to react with fatty acids and form mercaptans, which are volatile compounds that can cause irritation. Mercaptoacetic acid sodium salt reacts with potassium dichromate and forms mercaptans and other products, which may contribute to its toxicity.</p>Formula:C2H3NaO2SPurity:(Titration) Min. 90%Color and Shape:PowderMolecular weight:114.1 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/mol3-Fluoro-4-nitrobenzoic acid
CAS:<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molPancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H287N55O53SPurity:Min. 95%Molecular weight:4,209.71 g/molN-Fmoc-L-γ-carboxyglutamic acid γ,γ-di-t-butyl ester
CAS:<p>Please enquire for more information about N-Fmoc-L-gamma-carboxyglutamic acid gamma,gamma-di-t-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H35NO8Purity:Min. 95%Molecular weight:525.59 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Formula:C71H119N25O25SPurity:Min. 95%Molecular weight:1,754.92 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/molCytochrome C (88-104) (domestic pigeon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C84H144N24O25Purity:Min. 95%Molecular weight:1,890.19 g/molNaphthenic acid
CAS:<p>Naphthenic acid is a metal chelate that is used in synchronous fluorescence spectroscopy. It has been shown to have biodegradation properties and can be used as an indicator for water quality. Naphthenic acid has been found to be a potent inhibitor of corrosion and is often used as an additive to petroleum products, such as gasoline, that are made from crude oil. Naphthenic acid also has acute toxicities and can cause toxicity studies on humans. It is able to inhibit energy metabolism in cells by binding to the mitochondrial membrane, which may be due to its ability to bind with benzalkonium chloride. Naphthenic acid can also be used for analytical methods, such as electrochemical impedance spectroscopy, because it has high sensitivity and specificity.</p>Formula:C7H10O2Color and Shape:Clear LiquidMolecular weight:126.15 g/molChromone-2-carboxylic acid
CAS:<p>Chromone-2-carboxylic acid is a hydrochloric acid analog that is a prodrug for the formation of the active metabolite chromone-2,4-dihydroxybenzoic acid. Chromone-2-carboxylic acid has been shown to have anti-inflammatory properties in vitro and in vivo. It has also been shown to inhibit leukotriene synthesis by blocking the binding of LTC4 to its receptor.</p>Formula:C10H6O4Purity:Min. 95%Molecular weight:190.15 g/molLuteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt
CAS:<p>Luteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt is a potent antagonist of the luteinizing hormone-releasing hormone (LHRH) receptor. It is used specifically to treat platinum-resistant ovarian cancer, where it has been shown to be effective in reducing tumor size and volume. This drug has minimal toxicity and can be administered by injection or as a microcapsule. LHRH Antagonist trifluoroacetate salt is an analog of LHRH that has been modified so that it cannot cross the blood-brain barrier. It also binds to epidermal growth factor receptors, which are involved in cell proliferation, differentiation, and survival. Symptoms of overdose may include nausea, vomiting, headache, dizziness, seizures, and coma.</p>Formula:C48H59ClN12O8Purity:Min. 95%Molecular weight:967.51 g/molLeu-Enkephalin amide acetate salt
CAS:<p>Leu-Enkephalin amide acetate salt H-Tyr-Gly-Gly-Phe-Leu-NH2 acetate salt is a peptide that is used as an analgesic and antipyretic drug. It is a synthetic form of endogenous enkephalins, which are natural pain relievers. The chemical stability of Leu-Enkephalin amide acetate salt H-Tyr-Gly-Gly-Phe-Leu-NH2 acetate salt makes it an effective drug for chronic use, and it has been shown to have a low side effect profile. This compound also has been shown to block the synthesis of histamine in vivo, but its bioavailability in vivo is not high due to its rapid degradation by proteases.</p>Formula:C28H38N6O6Purity:Min. 95%Color and Shape:PowderMolecular weight:554.64 g/mol2-Amino-a-(methoxyimino)-4-thiazoleacetic acid
CAS:<p>2-Amino-a-(methoxyimino)-4-thiazoleacetic acid is a reaction product of cefotaxime and n-dimethyl formamide. It has been shown to be an effective agent for the treatment of wastewater with a high organic content. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid also reacts with chloride ions to form cleavage products that are soluble in water, making it an ideal choice for wastewater treatment. This compound is not toxic and can be used as a drug to treat patients with infections caused by bacteria resistant to other antibiotics. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid binds to mismatched base pairs in DNA, inhibiting DNA synthesis and causing cell death by apoptosis.</p>Formula:C6H7N3O3SPurity:Min. 95%Molecular weight:201.2 g/molNeuronostatin-19 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H153N29O26Purity:Min. 95%Molecular weight:2,069.37 g/molLHRH II trifluoroacetate salt
CAS:<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/mol1-Methyl-1-cyclohexanecarboxylic acid
CAS:<p>1-Methyl-1-cyclohexanecarboxylic acid is a fatty acid that is present in the conjugates of natural and synthetic oils. It is an unsaturated fatty acid with a cycloalkane ring structure. The synthesis of 1-methyl-1-cyclohexanecarboxylic acid has been shown to be catalyzed by a carboxylase, which converts acetyl CoA into malonyl CoA. This reaction is irreversible and can be used as the first step in the biosynthesis of fatty acids. 1-Methyl-1-cyclohexanecarboxylic acid has been shown to cause cell death in leukemia cells, as well as inhibit epileptic seizures in rats.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H79N13O12S2Purity:Min. 95%Molecular weight:1,034.3 g/mol(D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt
CAS:<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>Formula:C29H41N5O7SPurity:Min. 95%Molecular weight:603.73 g/molEthyl imidazole-2-carboxylate
CAS:<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>Purity:Min. 95%Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H141N21O30SPurity:Min. 95%Molecular weight:1,993.24 g/mol4-Methoxy-3-(trifluoromethyl)benzoic acid
CAS:<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>Formula:C9H7F3O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:220.15 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molMethyl 2-(2-aminophenyl)acetate
CAS:<p>Methyl 2-(2-aminophenyl)acetate is a synthetic compound that can be activated with nanomolar concentrations of cyanide. It is a potent cytotoxic agent that exhibits minimal activity in the presence of cells. Methyl 2-(2-aminophenyl)acetate has shown to have antiviral and antitumor properties, as well as potential use in cancer therapy. Methyl 2-(2-aminophenyl)acetate is synthesized by reacting an aldehyde group with a primary amine to produce an amide bond. This reaction also produces a linker molecule, which can be used for immobilization. Immobilization occurs when the chemical is bound to an insoluble support or carrier, such as silica gel or glass beads. Immobilization can increase the stability of the reactant, decrease its rate of degradation, and facilitate separation from unreacted components.</p>Formula:C9H11NO2Purity:Min. 95%Molecular weight:165.19 g/molBz-Val-Gly-Arg-AMC trifluoroacetate salt
CAS:<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>Formula:C30H37N7O6Purity:Min. 95%Molecular weight:591.66 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS:<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Formula:C54H78N16O10Purity:Min. 95%Molecular weight:1,111.3 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H107N21O18Purity:Min. 95%Molecular weight:1,626.81 g/molBz-Ile-Glu-Gly-Arg-pNA acetate salt
CAS:<p>Bz-Ile-Glu-Gly-Arg-pNA acetate salt is an anticoagulant that binds to heparin. It has been shown to inhibit protease activity in soybean trypsin by binding to the active site of the enzyme. Bz-Ile-Glu-Gly-Arg-pNA acetate salt has also been shown to have a molecular weight of heparin and a protein synthesis inhibition rate of fibrinogen, which is responsible for coagulation.</p>Formula:C32H43N9O9Purity:Min. 95%Molecular weight:697.74 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Formula:C13H14N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/molAmyloid β-Protein (25-35) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Formula:C45H81N13O14SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,060.27 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molAPL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS:<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Formula:C124H180N34O31Purity:Min. 95%Molecular weight:2,642.97 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/mol(Asp56)-pTH (1-84) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp56)-pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C405H668N122O126S3Purity:Min. 95%Molecular weight:9,358.58 g/mol(D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H99N19O15Purity:Min. 95%Molecular weight:1,338.56 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H234N46O52Purity:Min. 95%Molecular weight:3,465.7 g/molAmyloid β-Protein (1-24) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H183N35O40Purity:Min. 95%Molecular weight:2,876.06 g/mol2-Hydroxy-4-(methylthio)butanoic acid
CAS:<p>2-Hydroxy-4-(methylthio)butanoic acid (2HMB) is an amide that is used as a microbial metabolism inhibitor, especially for the inhibition of bacterial growth. 2HMB and its analogues are also used in plant physiology. 2HMB has been shown to have transport properties and can be used as an inorganic acid for the manufacture of hydrochloric acid. It has been found to have enzyme activities, such as polymerase chain reaction and hydroxyl group transferases, which make it a useful catalyst for reactions involving organic compounds. The hydroxyl group in 2HMB makes it a good candidate for use in fatty acid synthesis and oxidation reactions. Chronic exposure to this chemical may lead to carbonyl oxygen formation.</p>Formula:C5H10O3SPurity:Min. 95%Color and Shape:Yellow PowderMolecular weight:150.2 g/mol1-Acetylpiperidine-4-carboxylic acid
CAS:<p>1-Acetylpiperidine-4-carboxylic acid (ACPC) is a synthetic compound that has been shown to be a potent inhibitor of the neurokinin-1 receptor. ACPC has been shown to have anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. It has also been shown to have antipsychotic effects and could be an effective treatment for psychotic disorders. The pharmacophore of ACPC is based on the cyclohexane ring and piperidine moieties, which are thought to provide affinity for the neurokinin-1 receptor.</p>Formula:C8H13NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:171.19 g/molEthylenediaminetetraacetic acid tripotassium salt dihydrate
CAS:<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>Formula:C10H13K3N2O8·2H2OPurity:Min. 95%Molecular weight:442.54 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molDynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>Formula:C63H104N22O12Purity:Min. 95%Molecular weight:1,361.64 g/molBIM-23627 trifluoroacetate salt
CAS:<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O8S2Purity:Min. 95%Molecular weight:1,161.83 g/molAmyloid β-Protein (40-1) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molDL-3-Amino-3-phenylpropionic acid
CAS:<p>DL-3-Amino-3-phenylpropionic acid is an amino acid that is synthesized by the reaction of malonic acid and ethyl ester. This compound is a competitive inhibitor of the enzyme pyruvate carboxylase and inhibits this enzyme in the conversion of pyruvic acid to acetyl CoA, which plays a key role in metabolism. DL-3-Amino-3-phenylpropionic acid has been shown to inhibit the growth of bacteria such as Escherichia coli, Salmonella typhimurium and Staphylococcus aureus. The inhibition of pyruvate carboxylase by DL-3-Amino-3-phenylpropionic acid prevents the production of acetaldehyde from pyruvate, which is toxic to cells.</p>Formula:C9H11NO2Purity:Min. 95%Molecular weight:165.19 g/mol1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/molpTH (28-48) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H150N28O29Purity:Min. 95%Molecular weight:2,148.38 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molTRAF6 Control Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H232N34O42Purity:Min. 95%Molecular weight:3,051.53 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H160N34O27Purity:Min. 95%Molecular weight:2,210.5 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O7Purity:Min. 95%Molecular weight:651.71 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H128N32O20Purity:Min. 95%Molecular weight:1,918.13 g/mol(4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid
CAS:<p>Please enquire for more information about (4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:403.43 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H89N17O17Purity:Min. 95%Molecular weight:1,332.46 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H170N30O40SPurity:Min. 95%Molecular weight:2,656.84 g/molUndecanoic acid
CAS:<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>Formula:C11H22O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.29 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molFibronectin Adhesion-Promoting Peptide trifluoroacetate salt
CAS:<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>Formula:C47H74N16O10Purity:Min. 95%Molecular weight:1,023.19 g/molAbz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H48N12O12Purity:Min. 95%Molecular weight:828.83 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/mol4-(Dodecyloxy)benzoic Acid
CAS:<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>Purity:Min. 95%Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C67H85N15O11Purity:Min. 95%Molecular weight:1,276.49 g/mol3,5-Difluorobenzoic acid
CAS:<p>3,5-Difluorobenzoic acid is a pharmaceutical preparation that has been used in the treatment of inflammatory diseases and cancer. It is an enantiomer of 5-Fluorobenzoic acid. 3,5-Difluorobenzoic acid can be synthesized from 2,4-dichlorophenoxyacetic acid by cycloaddition process with fluorine. Magnetic resonance spectroscopy has shown that 3,5-Difluorobenzoic acid binds to oxytocin receptor. The binding of 3,5-Difluorobenzoic acid to oxytocin receptor leads to the activation of its G protein coupled receptor activity. This causes an increase in intracellular cAMP levels and subsequently leads to the inhibition of bacterial enzyme ns3 protease and cardiac hypertrophy induced by chronic angiotensin II infusion.</p>Purity:Min. 95%4-Methoxycarbonylphenylboronic acid
CAS:<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>Formula:C8H9BO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:179.97 g/molMca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H83N19O12Purity:Min. 95%Molecular weight:1,166.34 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/molUroguanylin Topoisomer A (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/mol3,4,5-Trichlorobenzoic acid
CAS:<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END></p>Purity:Min. 95%4-Fluorobenzoic acid
CAS:<p>4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.</p>Formula:C7H5FO2Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:140.11 g/molFulvic acid
CAS:<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>Formula:C14H12O8Purity:Min. 90%Color and Shape:PowderMolecular weight:308.24 g/molBenzopyrazine-6-boronic acidHCl
CAS:<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BClN2O2Purity:Min. 95%Molecular weight:210.43 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/mol4-Bromobutyl acetate
CAS:<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molTRH-AMC acetate salt
CAS:<p>TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt is a potent and selective histidine kinase inhibitor that modulates the activity of many enzymes. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has a molecular weight of 476.9 g/mol and chemical formula C12H14N2O4S. The compound was synthesized by reacting tris(2,4,6-trimethoxybenzoyl)amine with pyridoxal 5'-phosphate and histidine in acetic acid. The synthesis reaction yielded a white solid that was then recrystallized from methanol to yield the final product. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has been shown to inhibit the enzymatic activity of numerous enzymes at nanomolar concentrations including: protein kinases, phosphatases, ligases</p>Formula:C26H28N6O6Purity:Min. 95%Molecular weight:520.54 g/molGLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H248N42O52Purity:Min. 95%Molecular weight:3,784.1 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H239N47O46Purity:Min. 95%Molecular weight:3,340.71 g/molOrexin A (17-33) trifluoroacetate salt
CAS:<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Formula:C79H125N23O22Purity:Min. 95%Molecular weight:1,748.98 g/molVIP (4-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H221N39O36SPurity:Min. 95%Molecular weight:2,986.5 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N9O8Purity:Min. 95%Molecular weight:619.67 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formula:C61H110N24O14Purity:Min. 95%Molecular weight:1,403.68 g/molLys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>Formula:C47H75N13O11Purity:Min. 95%Molecular weight:998.18 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/mol7-Hydroxyheptanoic acid
CAS:<p>7-Hydroxyheptanoic acid is a fatty acid that has the hydroxyl group on the seventh carbon. It is biosynthesized from the hydroxylation of heptanal, which is catalyzed by a monooxygenase. The hydroxyl group in 7-hydroxyheptanoic acid can be oxidized to form a carboxylic acid (e.g., 7-ketoheptanoic acid). 7-hydroxyheptanoic acid can also be used as a coating material because it has functional groups and is biodegradable and metal ion free.</p>Formula:C7H14O3Purity:Min. 95%Molecular weight:146.18 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/mol(Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid
CAS:<p>Please enquire for more information about (Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H5N3O3SPurity:Min. 95%Molecular weight:187.18 g/molH-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS:<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H71N11O15Purity:Min. 95%Molecular weight:1,042.14 g/molPAR-4 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H42N8O8Purity:Min. 95%Molecular weight:618.68 g/molNesfatin-1 (30-59) (human) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H263N41O54Purity:Min. 95%Molecular weight:3,709.12 g/molRenin Substrate 1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Renin Substrate 1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H157N31O22S2Purity:Min. 95%Molecular weight:2,317.74 g/molEthylene glycol monoacetoacetate monomethacrylate
CAS:<p>Ethylene glycol monoacetoacetate monomethacrylate is a metal chelate that is used to treat muscle diseases. It has been shown to act as a gamma-aminobutyric acid agonist and inhibit the release of acetylcholine from nerve endings. This drug can also be used as a chemical stabilizer in the synthesis of polymers in organic chemistry. Ethylene glycol monoacetoacetate monomethacrylate is insoluble in water and soluble in organic solvents such as ethanol, acetone, or benzene. It has been found to have a phase transition temperature at -139°C, which is suitable for applications that require low temperatures. Ethylene glycol monoacetoacetate monomethacrylate reacts with sodium carbonate to form an ester and methacrylic acid (MAA). The reaction solution is typically heated with stirring until it reaches 40°C-50°C. The particle size of</p>Formula:C10H14O5Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:214.22 g/mol3-Cyano-2-methylphenylboronic acid
CAS:<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>Formula:C8H8BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.97 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H96N16O17S2Purity:Min. 95%Molecular weight:1,509.75 g/molN-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid
CAS:<p>N-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid is a potential drug for hypercholesterolemia. It has been shown to lower LDL cholesterol and triglycerides levels in monkeys. The compound is orally bioavailable and can be taken orally. This drug also has the potential to be developed as a PCSK9 (proprotein convertase subtilisin/kexin type 9) inhibitor.</p>Formula:C11H21NO6Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.29 g/molNeuropeptide Y (18-36) trifluoroacetate salt
CAS:<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>Formula:C112H174N36O27Purity:Min. 95%Molecular weight:2,456.81 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/molH-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N4O4Purity:Min. 95%Molecular weight:260.29 g/molH-Arg-His-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N8O2Purity:Min. 95%Molecular weight:310.36 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H258N52O44S5Purity:Min. 95%Molecular weight:3,690.34 g/molTRAP-14 trifluoroacetate salt
CAS:<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>Formula:C81H118N20O23Purity:Min. 95%Molecular weight:1,739.92 g/molTRAP-5 trifluoroacetate salt
CAS:<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>Formula:C30H50N8O7Purity:Min. 95%Molecular weight:634.77 g/molModafinil carboxylate
CAS:<p>Modafinil is a drug that belongs to the class of wakefulness-promoting agents. It has been shown to have a long half-life and low toxicity in humans, which may be due to its effects on cytochrome P450 isoenzymes. Modafinil has been studied in clinical trials for its tolerability, with no significant side effects reported. The drug has also been shown to have anticonvulsant properties and can be used as an adjunctive treatment for patients with partial seizures. Modafinil binds to the GABA receptor in the brain and increases GABAergic neurotransmission. The compound's mechanism of action is not fully understood, but it is believed that it acts by inhibiting cyclic AMP degradation and increasing cAMP levels in the brain. This increase in cAMP levels may lead to increased protein kinase activity, decreased phosphorylation of glutamate receptors, increased release of dopamine, and decreased release of histamine from mast cells.</p>Formula:C15H14O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:274.34 g/molCyclohexylacetic acid
CAS:<p>Cyclohexylacetic acid is a cyclic fatty acid that has been shown to inhibit the production of gamma-aminobutyric acid in hl-60 cells. This inhibition leads to an increase in epidermal growth factor and a decrease in malonic acid. Cyclohexylacetic acid also inhibits microbial metabolism by preventing the conversion of nitrogen atoms into ammonia, which can cause cardiac arrest or sublethal doses. The effects of cyclohexylacetic acid on coronary heart disease have not been determined because it is not commercially available for purchase.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/mol3-Bromo-6-methylpicolinic acid
CAS:<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H6BrNO2Purity:Min. 95%Molecular weight:252.49 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O16Purity:Min. 95%Molecular weight:1,415.68 g/molH-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H58N12O9Purity:Min. 95%Molecular weight:850.96 g/mol(d(CH2)51,Tyr(Me)2,Thr4, Orn 8,Tyr-NH29)-Vasotocin trifluoroacetate salt
CAS:<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br>br><br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>Formula:C54H79N11O13S2Purity:Min. 95%Molecular weight:1,154.4 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H22N4O5·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:440.37 g/molCGRP (chicken) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C165H262N52O50S2Purity:Min. 95%Molecular weight:3,838.3 g/molH-Thr-Lys-Pro-Pro-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H47N9O7Purity:Min. 95%Molecular weight:597.71 g/molMethyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate
CAS:<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>Formula:C11H10O3Purity:Min. 95%Molecular weight:190.2 g/mol2,7-Naphthalenedicarboxylicacid
CAS:<p>2,7-Naphthalenedicarboxylic acid is a synthetic compound that belongs to the group of aromatic hydrocarbons. It has been shown to have magnetic resonance spectroscopy (MRS) and X-ray structures that are similar to those of phenyl substituents. 2,7-Naphthalenedicarboxylic acid also shows supramolecular interactions with other molecules. The asymmetry can be explained by the presence of a nitrogen atom in the molecule, which can form intramolecular hydrogen bonds.</p>Formula:C12H8O4Purity:Min. 95%Molecular weight:216.19 g/molNeuropeptide γ trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C99H158N34O29SPurity:Min. 95%Molecular weight:2,320.59 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H105N17O12SPurity:Min. 95%Molecular weight:1,384.73 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Formula:C5H11NS2•Na•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:226.32 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molAPL1b27 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H174N30O38SPurity:Min. 95%Molecular weight:2,472.73 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/mol2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid
CAS:<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BF2O4Purity:Min. 95%Molecular weight:201.92 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/mol(Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H231N45O41Purity:Min. 95%Molecular weight:3,188.6 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H125N27O29Purity:Min. 95%Molecular weight:2,001.08 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS:<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17NO3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:199.25 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Molecular weight:208.07 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molDi-tert-butyl azodicarboxylate
CAS:<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>Formula:C10H18N2O4Purity:Min. 98%Color and Shape:PowderMolecular weight:230.26 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/molNFAT Inhibitor trifluoroacetate salt
CAS:<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>Formula:C75H118N20O22SPurity:Min. 95%Molecular weight:1,683.93 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H244N40O42SPurity:Min. 95%Molecular weight:3,335.87 g/mol2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid
CAS:<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7N3O2S2Purity:Min. 95%Color and Shape:PowderMolecular weight:217.27 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N19O16Purity:Min. 95%Molecular weight:1,508.77 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H295N55O51S2Purity:Min. 95%Molecular weight:4,217.84 g/molEthyl 2-fluoroacetoacetate
CAS:<p>Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.</p>Formula:C6H9FO3Purity:Min. 95%Molecular weight:148.13 g/mol3-Bromophenyl boronic acid
CAS:<p>3-Bromophenyl boronic acid is a group P2 molecule with functional groups of vibrational and cross-coupling. It has been shown to inhibit the activity of aryl boronic acids, which are commonly used in analytical methods. 3-Bromophenyl boronic acid is also capable of inhibiting the production of alizarin, which is a dye that is used for staining biological tissue. The molecular modeling study revealed that this molecule has an atomic orbital with electron density distribution around the central carbon atom. This distribution indicates that it is more stable than other molecules with similar structures.</p>Formula:C6H6BBrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:200.83 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H86N16O13Purity:Min. 95%Molecular weight:1,251.44 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Formula:C72H116N22O29Purity:Min. 95%Molecular weight:1,753.82 g/mol3-(Trifluoromethyl)phenylacetic acid
CAS:<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>Formula:C9H7F3O2Purity:Min. 95%Molecular weight:204.15 g/molH-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/molGambogic acid
CAS:<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>Purity:Min. 95%5-bromo-2-(trifluoromethyl)benzoic Acid
CAS:<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H4BrF3O2Purity:Min. 95%Molecular weight:269.02 g/mol(Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H293N55O50Purity:Min. 95%Molecular weight:4,087.65 g/mol2-Fluoro-6-methylbenzoic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molFmoc-L-glutamic acid γ-methyl ester
CAS:<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO6Purity:Min. 95%Molecular weight:383.39 g/mol
