Carboxylic Acids

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>Please enquire for more information about Z-Leu-Arg-Gly-Gly-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>Please enquire for more information about Methyl isoindoline-5-carboxylate HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>

<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>

<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>

<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>

<p>5-Aminopyridine-3-carboxylic acid (5APC) is a structural analog of nicotinic acid that has been shown to have anti-inflammatory effects. 5APC inhibits the production of inflammatory cytokines, such as IL-10 and IL-17, by inhibiting the activation of NFκB and MAPK pathways. This drug also has significant inhibitory activities against dextran sulfate sodium (DSS)-induced acute colitis in experimental models. 5APC is thought to act by interrupting the assembly of p38 mitogen activated protein kinase (MAPK) and nuclear factor kappa B (NFκB) signaling complexes.</p>

<p>Please enquire for more information about (Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asp76)-pTH (39-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Structure/Function: human; Trifluoroacetate salt</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>2-(2-Methoxyethoxy)ethoxy)acetic acid (MEAA) is a cell stabilizer that can be used in the treatment of cancer, diabetes, and other diseases. MEAA has been shown to inhibit the growth of cells by binding to and stabilizing the cytoskeleton through inhibition of protein synthesis. It also prevents the activation of pro-inflammatory cytokines and reactive oxygen species. MEAA's magnetic resonance spectroscopy properties have been studied in detail and it has been shown to bind well with silver ions. MEAA has also been shown to have high cytotoxicity when combined with laser ablation therapy.</p>

<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.​</p>

<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>

<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>

<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>

<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>

<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>

<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>

<p>3,5-Diiodothyroformic acid is a fine chemical that is used as a versatile building block in organic synthesis. It is also an intermediate for research chemicals and speciality chemicals. In addition to its use as a reagent, 3,5-Diiodothyroformic acid has been shown to be useful as a building block for the synthesis of pharmaceuticals and agricultural chemicals.</p>

<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Fluorophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>

<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.</p>

<p>Intermediate in the synthesis of afatinib</p>

<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Piperazinoacetic acid anilide dihydrochloride is a high quality, reagent compound which can be used as a useful intermediate or a speciality chemical. Piperazinoacetic acid anilide dihydrochloride is a complex compound that has been shown to have a number of useful properties, such as being an effective building block for the synthesis of other compounds. It can also be used as a reaction component in the preparation of fine chemicals and research chemicals. This product is also versatile, allowing it to be built into different scaffolds to create new compounds.</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>

<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>1,1-Cyclohexanediacetic acid anhydride is a synthetic polymer that is soluble in water. It is used in wastewater treatment to remove organic contaminants. 1,1-Cyclohexanediacetic acid anhydride reacts with gabapentin to form amide and monoamide derivatives. This reaction is catalyzed by acylation agents such as hydrochloric acid and organic solvents such as benzene. The resulting products are virulent, allowing them to be used in the treatment of epilepsy.</p>

<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>