Carboxylic Acids

<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about (Lys7)-Dermorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>

<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>

<p>Candesartan is a selective angiotensin II receptor antagonist that inhibits the binding of angiotensin II to its receptors, which in turn decreases the activity of angiotensin-converting enzyme. Candesartan cilexetil is an ester prodrug that has been shown to be effective in the treatment of high blood pressure. In the crystalline form, candesartan cilexetil is a white powder with a melting point of 130–135 °C and a solubility in water of &gt;1 g/L. The molecular weight of candesartan cilexetil is 393.8 g/mol and it has a molecular formula C17H21NO2S. The chemical structure consists of two benzimidazole rings coupled together through an ethyl-2-ethoxy linker and attached to a carboxylate group on one end and an amide group on the other</p>

<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>

<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br&gt;br&gt; Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>3-(3,4-Dichlorophenyl)propanoic acid is a potent inhibitor of the lysine methyltransferase enzyme. This enzyme catalyzes the transfer of methyl groups from S-adenosylmethionine to lysine residues in proteins, and it is involved in cancer cell proliferation. 3-(3,4-Dichlorophenyl)propanoic acid inhibits the activity of this enzyme by covalently binding to lysine residues on the protein and preventing their methylation. Research has shown that 3-(3,4-Dichlorophenyl)propanoic acid can block tumor growth by inhibiting the activity of this enzyme.</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>

<p>Please enquire for more information about (Des-Gly2)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt is an experimental drug that belongs to the group of peptide hormones. It has been shown to have beneficial effects on bowel disease in animal models and also has anti-inflammatory properties. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt activates the T cell receptor and stimulates cytokine production, thereby reducing inflammation and relieving symptoms of autoimmune diseases. Splenopentin acetate salt H-Arg-Lys-Glu-Val-Tyr-OH acetate salt also stimulates colonies of cells called macrophages, which then produce inflammatory mediators such as IL1, IL2, IL4, and IL6. This agent is biocompatible with human cells in vitro (in a test tube).</p>

<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated until</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>

<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>

<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>

<p>Please enquire for more information about tert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>

<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>

<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>

<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu is a galanin analog and a ligand for the galanin receptor 1. It has affinity for the receptors in the brain, which are involved in cognition, and is used to study Alzheimer's disease. Galanin (2-11) amide trifluoroacetate salt H-Trp-Thr-Leu-Asn-Ser -Ala -Gly -Tyr -Leu -Leu is a member of the family of neuropeptides and neuromodulators that regulate nerve injury and alzheimer's disease.</p>

<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>

<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>

<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Maleimidomethylcyclohexanecaroboxylic acid (4MAMC) is a bifunctional molecule that is conjugated to a polymer, which has the ability to bind with cellular antigens and target tissue. It is used in clinical chemistry because it can be detected at low concentrations. 4MAMC has been shown to reduce cirrhosis caused by chronic liver injury. 4MAMC also increases the uptake of coagulation factors and decreases the expression of prothrombin, which leads to an increase in clotting time. The localization of 4MAMC is determined by the type of polymer conjugate it is bound with; for example, when it binds with human serum albumin, it localizes on the surface of cells.</p>

<p>Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Pyridinylboronic acid is a boron compound that contains two nitrogen atoms. It is an important reagent in organic synthesis and crystallography. 4-Pyridinylboronic acid has been shown to have biological properties, such as hydrogen bonding interactions. It is also used in the suzuki coupling reaction and the photochemical properties of the reaction solution are dependent on its coordination geometry. 4-pyridinylboronic acid has a high pH value, so it must be prepared in anhydrous sodium carbonate before use. The hydrogen bond between 4-pyridinylboronic acid and an azide is shown below: Nnowiki&gt;/nowiki&gt;Hnowiki&gt;/nowiki&gt;nowiki&gt;/nowiki&gt;Nnowiki&gt;/nowiki&gt;nowiki&gt;/nowiki&gt;H</p>

<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-(-)-3-Amino-3-phenylpropionic acid is a hydrogenated, stereoselective β-amino acid that is involved in the biosynthesis of animal health. The enzyme acylase catalyzes this reaction by binding with chiral pyridoxal phosphate to form an acylation product. The stereospecificity of the reaction is determined by whether the enzyme has a preference for L or D amino acids. Acylases are found in organisms such as mammals and bacteria.</p>

<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>

<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>