
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
2-(Carboxymethyl)-4,5-dimethoxybenzoic acid
CAS:<p>Please enquire for more information about 2-(Carboxymethyl)-4,5-dimethoxybenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H12O6Purity:Min. 95%Molecular weight:240.21 g/mol3-Chloroquinoxaline-2-carboxylic acid
CAS:<p>3-Chloroquinoxaline-2-carboxylic acid is a synthetic compound that has been shown to have antimicrobial properties against bacteria. It is a quinoxaline derivative, which is an important class of compounds for the development of new antibiotics. 3-Chloroquinoxaline-2-carboxylic acid has been shown to inhibit bacterial growth through different mechanisms including blocking DNA synthesis, binding to RNA polymerase, and inhibiting protein synthesis. It also has been shown to be effective against drug resistant bacteria such as methicillin resistant Staphylococcus aureus (MRSA).</p>Formula:C9H5ClN2O2Purity:Min. 95%Molecular weight:208.6 g/molPhenyl pyruvic acid
CAS:<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>Formula:C9H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:164.16 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/moltert-Butyl carbamate
CAS:<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>Formula:C5H11NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:117.15 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H224N46O47S9Purity:Min. 95%Molecular weight:3,676.23 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/molCART (61-102) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H310N58O56S7Purity:Min. 95%Molecular weight:4,515.3 g/molEtiroxate carboxylic acid
CAS:<p>Please enquire for more information about Etiroxate carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H13I4NO4Purity:Min. 95%Molecular weight:790.9 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H277N51O56SPurity:Min. 95%Molecular weight:4,131.54 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/molα-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H94N22O21Purity:Min. 95%Molecular weight:1,423.49 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS:<p>Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H75Na2O8PPurity:Min. 95%Molecular weight:748.96 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molBoc-Arg-Val-Arg-Arg-AMC acetate salt
CAS:Controlled Product<p>Boc-Arg-Val-Arg-Arg-AMC acetate salt is a protease inhibitor that belongs to the group of basic proteins. It inhibits the action of serine proteases, which are enzymes that break down proteins in cells. Boc-Arg-Val-Arg-Arg-AMC acetate salt has been shown to inhibit leishmania and tumor cell growth. It also inhibits cancer cell proliferation and metastasis. The inhibition of these cancer cell lines by Boc-Arg-Val-Arg-Arg-AMC acetate salt may be due to its ability to inhibit protein synthesis, which is vital for tumor cell growth. Boc Arg Val Arg Arg AMC acetate salt also induces apoptosis (cell death) in some cancer cells through the activation of caspase 3, a cysteine protease that plays an important role in apoptosis signaling pathways.</p>Formula:C38H62N14O8Purity:Min. 95%Molecular weight:842.99 g/molTetrahydro-3-furoic acid
CAS:<p>Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. Tet</p>Formula:C5H8O3Purity:Min. 95%Molecular weight:116.12 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/molGalanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C292H451N83O84SPurity:Min. 95%Molecular weight:6,500.28 g/mol3-[(2-Aminoethyl)dithio]propionic acid
CAS:<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>Formula:C5H11NO2S2Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:181.28 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/molDodecylbenzenesulfonic acid, 70% in isopropanol
CAS:<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>Formula:C18H30O3SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:326.5 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol5-Phenylisoxazole-3-carboxylic acid
CAS:<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>Formula:C10H7NO3Purity:Min. 95%Molecular weight:189.17 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/mol2-Bromo-4,5-dimethoxybenzoic acid
CAS:<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>Formula:C9H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:261.07 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/molDefensin HNP-2 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formula:C147H217N43O37S6Purity:Min. 95%Molecular weight:3,370.96 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/mol([ring-D5]Phe3)-Octreotide acetate salt
CAS:Controlled Product<p>Please enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H61D5N10O10S2Purity:Min. 95%Molecular weight:1,024.27 g/mol4-(Dodecyloxy)benzoic Acid
CAS:<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>Purity:Min. 95%(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/mol4-Fluorobenzoic acid
CAS:<p>4-Fluorobenzoic acid is a chemical compound with the molecular formula C6H4FO2 and is a member of the group of chemicals known as carboxylic acids. It has been shown to have high levels of antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). 4-Fluorobenzoic acid can be used for wastewater treatment and also has the potential to be used in other applications such as an antimicrobial agent or an additive in food packaging. The mechanism of its antibacterial activity is not well understood but may be related to its ability to inhibit the enzyme diphenolase, which catalyzes the conversion of phenols into quinones.</p>Formula:C7H5FO2Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:140.11 g/mol1-(Mercaptomethyl)cyclopropaneacetic acid
CAS:<p>1-(Mercaptomethyl)cyclopropaneacetic acid is a reaction product of hydrolysis, transfer, and industrialization. It is used in the synthesis of organic compounds such as quinolinediols and thioureas. 1-(Mercaptomethyl)cyclopropaneacetic acid is typically prepared by the reaction of an alkylsulfonyl chloride with an inorganic base such as lithium or sodium carbonate in an organic solvent such as acetonitrile. The compound is also used to produce other organosulfur compounds, including imino sulfides and disulfides.</p>Formula:C6H10O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:146.21 g/mol(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid
CAS:<p>(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is an antibacterial agent that inhibits the enzyme acetylcholine esterase. This inhibition prevents the breakdown of acetylcholine, leading to increased levels of this neurotransmitter in the brain and an enhancement of cholinergic transmission. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid has been shown to be effective against bacterial strains resistant to β-lactam antibiotics. The synthesis of taxol as well as other β-amino acids has been demonstrated using a variety of enzymatic methods. A reaction scheme for the synthesis of nicotinic acetylcholine has also been proposed. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is a dipept</p>Formula:C10H10F3NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:233.19 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H246N44O38Purity:Min. 95%Molecular weight:3,273.83 g/molH-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H58N12O9Purity:Min. 95%Molecular weight:850.96 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS:Controlled Product<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O6·C2H4O2Purity:Min. 95%Molecular weight:391.42 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:<p>Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.</p>Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/mol3-Chlorophenyl acetic acid
CAS:<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Formula:C8H7ClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:170.59 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C44H68N10O18S2Purity:Min. 95%Molecular weight:1,089.2 g/mol(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester
CAS:<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>Formula:C12H16O3Purity:Min. 95%Color and Shape:LiquidMolecular weight:208.25 g/molpTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C414H672N122O128S2Purity:Min. 95%Molecular weight:9,470.64 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H70N12O20Purity:Min. 95%Molecular weight:1,195.19 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol(D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt
CAS:<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>Formula:C12H19N3O4Purity:Min. 95%Molecular weight:269.3 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O8Purity:Min. 95%Molecular weight:576.6 g/molH-Pro-Phe-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O4Purity:Min. 95%Molecular weight:390.48 g/molH-D-Arg(Me)-OH acetate salt
CAS:Controlled Product<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formula:C7H16N4O2Purity:Min. 95%Molecular weight:188.23 g/molHel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molEthoxyiminoacetic acid ethyl ester
CAS:<p>Ethoxyiminoacetic acid ethyl ester is an annulated, lactam-containing compound that is synthesized via the condensation of ethyl thiooxamate and carboxylic acid. This drug has been shown to be efficient in inhibiting the growth of bacteria that are resistant to antibiotics such as polycyclic, triazoles, and condensates. It also inhibits protein synthesis by binding to bacterial DNA gyrase and topoisomerase IV. Ethoxyiminoacetic acid ethyl ester has shown significant antimicrobial activity against Gram-positive bacteria such as streptococci and staphylococci.</p>Formula:C6H11NO3Purity:Min. 95%Molecular weight:145.16 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/molNeuropeptide F trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H328N58O58Purity:Min. 95%Molecular weight:4,593.21 g/molVEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H99N23O18SPurity:Min. 95%Molecular weight:1,666.82 g/molAmyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H81N17O16Purity:Min. 95%Molecular weight:1,104.22 g/molNeurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt
CAS:<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>Formula:C78H121N21O20Purity:Min. 95%Molecular weight:1,672.92 g/molH-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br>br> H-Arg-Arg-OH acetate salt is found in cyanob</p>Formula:C12H26N8O3Purity:Min. 95%Molecular weight:330.39 g/molH-Arg-Ile-OH acetate salt
CAS:<p>H-Arg-Ile-OH acetate salt is a regulatory protein that is found in plant cells. It has been shown to be involved in the regulation of cancer, as well as having some anti-inflammatory activities. H-Arg-Ile-OH acetate salt also has been shown to inhibit the production of fatty acids and coagulation factors by inhibiting serine proteases and thromboplastin activity, respectively. H-Arg-Ile-OH acetate salt may have an important role in regulating blood clotting by preventing fibrinogen from converting to fibrin, which leads to clot formation.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/mol(D-His2,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molGastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H209N35O38SPurity:Min. 95%Molecular weight:3,010.43 g/molMethyl carbamate
CAS:<p>Methyl carbamate is a carbamate that inhibits a number of enzymes, including mitochondrial membrane potential, cell nuclei, and dinucleotide phosphate. It also inhibits the synthesis of DNA, RNA, and proteins. Methyl carbamate has been shown to inhibit the growth of infectious diseases such as malaria and tuberculosis. It is a potent inhibitor of hyperproliferative diseases such as cancer. Methyl carbamate is used in analytical chemistry to determine the amount of an unknown compound in a sample by measuring its concentration with mass spectrometry or other methods. The compound can be prepared in various ways depending on the type of analysis needed. Methyl carbamate is usually prepared by reacting methyl iodide with sodium cyanide at 150 °C for 24 hours.</p>Formula:C2H5NO2Purity:Min. 95%Molecular weight:75.07 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H82N16O17SPurity:Min. 95%Molecular weight:1,403.52 g/molMet-Enkephalin acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H35N5O7S·xC2H4O2Purity:Min. 95%Molecular weight:573.66 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N61O60SPurity:Min. 95%Molecular weight:4,449.84 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/molEndothelin-2 (human, canine) acetate
CAS:<p>Acetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H63N15O13Purity:Min. 95%Molecular weight:1,082.13 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C157H252N44O43SPurity:Min. 95%Molecular weight:3,476.02 g/moltert-Butyl acetate
CAS:<p>tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.</p>Formula:C6H12O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:116.16 g/mol(D-Trp8)-Somatostatin-14 trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H104N18O19S2Purity:Min. 95%Molecular weight:1,637.88 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>Formula:C190H287N55O57Purity:Min. 95%Molecular weight:4,253.65 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molZ-Arg-Arg-bNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/molSecretin (porcine) acetate salt
CAS:Controlled Product<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Formula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/mol(Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt
<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H276N46O45Purity:Min. 95%Molecular weight:3,768.37 g/mol(Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H293N55O50Purity:Min. 95%Molecular weight:4,087.65 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/molFmoc-L-Lys[Oct-(otBu)-Glu-(otBu)-AEEA-AEEA]-OH
CAS:<p>Please enquire for more information about Fmoc-L-Lys[Oct-(otBu)-Glu-(otBu)-AEEA-AEEA]-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H101N5O16Purity:Min. 95%Molecular weight:1,196.51 g/mol(D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H95N19O13Purity:Min. 95%Molecular weight:1,338.56 g/molChlorotoxin trifluoroacetate salt
CAS:<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>Formula:C158H249N53O47S11Purity:Min. 95%Molecular weight:3,995.72 g/molCyclohexylacetic acid
CAS:<p>Cyclohexylacetic acid is a cyclic fatty acid that has been shown to inhibit the production of gamma-aminobutyric acid in hl-60 cells. This inhibition leads to an increase in epidermal growth factor and a decrease in malonic acid. Cyclohexylacetic acid also inhibits microbial metabolism by preventing the conversion of nitrogen atoms into ammonia, which can cause cardiac arrest or sublethal doses. The effects of cyclohexylacetic acid on coronary heart disease have not been determined because it is not commercially available for purchase.</p>Formula:C8H14O2Purity:Min. 95%Molecular weight:142.2 g/molModafinil carboxylate
CAS:<p>Modafinil is a drug that belongs to the class of wakefulness-promoting agents. It has been shown to have a long half-life and low toxicity in humans, which may be due to its effects on cytochrome P450 isoenzymes. Modafinil has been studied in clinical trials for its tolerability, with no significant side effects reported. The drug has also been shown to have anticonvulsant properties and can be used as an adjunctive treatment for patients with partial seizures. Modafinil binds to the GABA receptor in the brain and increases GABAergic neurotransmission. The compound's mechanism of action is not fully understood, but it is believed that it acts by inhibiting cyclic AMP degradation and increasing cAMP levels in the brain. This increase in cAMP levels may lead to increased protein kinase activity, decreased phosphorylation of glutamate receptors, increased release of dopamine, and decreased release of histamine from mast cells.</p>Formula:C15H14O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:274.34 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H151N31O26S2Purity:Min. 95%Molecular weight:2,099.44 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Molecular weight:555.63OM99-2trifluoroacetate salt
CAS:<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H64N8O14Purity:Min. 95%Molecular weight:892.99 g/mol2,3,6-Trifluorophenylacetic acid
CAS:<p>Please enquire for more information about 2,3,6-Trifluorophenylacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Urocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molLinolenic acid - 98%
CAS:<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>Formula:C18H30O2Purity:Min. 95%Color and Shape:PowderMolecular weight:278.43 g/mol4-(Trimethylsilyl)pheNylboroNic acid
CAS:<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>Formula:C9H15BO2SiPurity:Min. 95%Molecular weight:194.11 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molAdrenomedullin (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C262H403N79O76S3Purity:Min. 95%Molecular weight:5,971.69 g/mol2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid
CAS:<p>Please enquire for more information about 2-(4-((aminothioxomethyl)amino)-3,5-thiazolyl)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H7N3O2S2Purity:Min. 95%Color and Shape:PowderMolecular weight:217.27 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H16N2O3SPurity:85%MinMolecular weight:292.35 g/molAmyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H76N14O13Purity:Min. 95%Molecular weight:1,081.23 g/molUndecanoic acid
CAS:<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>Formula:C11H22O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.29 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molH-Val-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Val-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H18N2O3Purity:Min. 95%Molecular weight:274.32 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/molACV trifluoroacetate salt
CAS:<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>Formula:C14H25N3O6SPurity:Min. 95%Molecular weight:363.43 g/mol4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester
CAS:<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H23ClN2O3Purity:Min. 95%Molecular weight:374.86 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/mol7-Hydroxynaphthalene-1-sulfonic acid
CAS:<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>Purity:Min. 95%Human CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O7Purity:Min. 95%Molecular weight:651.71 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molLithium acetoacetate
CAS:<p>Lithium acetoacetate is a compound that is used in the treatment of cancer. It is a salt that contains lithium and acetoacetate. Lithium acetoacetate has been shown to be clinically relevant for the treatment of cancer, particularly in patients who have not responded well to other treatments. This drug has also been shown to induce apoptosis in animal cells, which may be due to its ability to produce acid.</p>Formula:C4H6O3•LiPurity:Min. 95%Color and Shape:PowderMolecular weight:109.03 g/molLHRH II trifluoroacetate salt
CAS:<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Formula:C7H8N2O2·xHClPurity:(%) Min. 60%Color and Shape:PowderMolecular weight:188.61 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/mol(Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Leu6,[13C6]Leu7,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Fluoro-4-nitrobenzoic acid
CAS:<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/molMca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H105N19O19SPurity:Min. 95%Molecular weight:1,656.86 g/molEthyl 2-(2-chloroethoxy)acetate
CAS:<p>Please enquire for more information about Ethyl 2-(2-chloroethoxy)acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H11ClO3Purity:Min. 95%Molecular weight:166.6 g/moltrans-2,5-Difluorocinnamic acid
CAS:<p>Trans-2,5-difluorocinnamic acid is a monomer that belongs to the group of organic acids. It is used as a solvent and in analytical methods. Trans-2,5-difluorocinnamic acid is also used to transport other substances and can be used in reactions with other molecules. Trans-2,5-difluorocinnamic acid has been shown to be neuropathic and has been tested for its ability to cause cataracts, but has not shown any evidence of mutagenicity.</p>Formula:C9H6F2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:184.14 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molAmyloid β-Protein (16-20) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with the development of Alzheimer's disease. The Aβ(16-20) trifluoroacetate salt (ATF) has been used in the diagnosis of Alzheimer's disease by fluorescence microscopy. This compound binds to hyaluronic acid and has been used as a coating for optical fibers and other materials, such as coatings for mitochondria for use in live cell imaging. The ATF also interacts with mitochondria and alters mitochondrial membrane potential, which may be due to its ability to displace cardiolipin from the inner mitochondrial membrane. ATF binds to unsymmetrical dimethylarginine (DMA), an endogenous nitric oxide synthase inhibitor, and selectively inhibits only cancer cells that have elevated levels of DMA. ATFP also induces spontaneous apoptosis in human carcinoma cells when bound to these cells via a photoconjugation reaction with bioconjugate chemistry.</p>Formula:C35H52N6O6Purity:Min. 95%Molecular weight:652.82 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS:<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17NO3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:199.25 g/molAc-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/molIntermedin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Intermedin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C226H361N75O64S2Purity:Min. 95%Molecular weight:5,216.88 g/mol2-Pyrimidine-carboxylic acid
CAS:<p>2-Pyrimidine-carboxylic acid is a biologically active molecule that can be found in the human body. It is a derivative of pyrimidine, which belongs to the group of purines. 2-Pyrimidine-carboxylic acid has been shown to inhibit the nicotinic acetylcholine receptor and α7 nicotinic acetylcholine receptor, which are receptors for acetylcholine. This molecule also has antihypertensive activity and has been shown to have therapeutic effects in psychotic disorders. 2-Pyrimidine-carboxylic acid binds to picolinic acid, which is an important intermediate in the metabolism of tryptophan, and hydroxyl group, which is essential for many biological functions. It also reacts with copper ions and forms a complex that is x-ray crystal structure confirmed. This complex may be used as a herbicide resistance inducer or as a chemical species for receptor binding studies or chemical reactions.</p>Formula:C5H4N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:124.1 g/molOrotic acid hydrate
CAS:<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>Formula:C5H4N2O4·H2OPurity:Min. 95 Area-%Color and Shape:PowderMolecular weight:174.11 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/molMethylboronic acid pinacol ester
CAS:<p>Methylboronic acid pinacol ester is an orally administered compound that inhibits the activity of peptidases and imidazole derivatives. It is used as a medicinal preparation for the treatment of cancer and other diseases. Methylboronic acid pinacol ester has been shown to inhibit the growth of bacteria, including Gram-positive bacteria such as methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens. This compound also has an inhibitory effect on hydroxyl group metabolism, which may be related to its anti-inflammatory properties.</p>Formula:C7H15BO2Purity:Min. 95%Color and Shape:Colourless liquid.Molecular weight:142 g/mol(Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H296N54O56Purity:Min. 95%Molecular weight:4,292.77 g/mol1-Oxo-indan-5-carboxylicacid
CAS:<p>Please enquire for more information about 1-Oxo-indan-5-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/molMethyl isoindoline-5-carboxylate HCl
CAS:<p>Please enquire for more information about Methyl isoindoline-5-carboxylate HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12ClNO2Purity:Min. 95%Molecular weight:213.66 g/molZ-Leu-Arg-Gly-Gly-AMC acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Leu-Arg-Gly-Gly-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H44N8O8Purity:Min. 95%Molecular weight:692.76 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H109N23O18SPurity:Min. 95%Molecular weight:1,628.86 g/mol(3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt
CAS:Controlled Product<p>Please enquire for more information about (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H33I2N5O6Purity:Min. 95%Molecular weight:765.38 g/molSalusin-β (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C115H176N32O21Purity:Min. 95%Molecular weight:2,342.83 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H83N13O14Purity:Min. 95%Molecular weight:1,042.23 g/mol4-Amino-2-methylbenzoic acid
CAS:<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>Formula:C8H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:151.16 g/molNociceptin trifluoroacetate salt
CAS:<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809.04 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H37N5O4•3C2H4O2Purity:Min. 95%Molecular weight:567.67 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H66N10O18Purity:Min. 95%Molecular weight:1,023.05 g/mol1,1-Cyclohexanediacetic acid anhydride
CAS:<p>1,1-Cyclohexanediacetic acid anhydride is a synthetic polymer that is soluble in water. It is used in wastewater treatment to remove organic contaminants. 1,1-Cyclohexanediacetic acid anhydride reacts with gabapentin to form amide and monoamide derivatives. This reaction is catalyzed by acylation agents such as hydrochloric acid and organic solvents such as benzene. The resulting products are virulent, allowing them to be used in the treatment of epilepsy.</p>Formula:C10H14O3Purity:Min. 95%Molecular weight:182.22 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H51N9O8·xC2H4O2Purity:Min. 95%Molecular weight:725.84 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H270N48O51S2Purity:Min. 95%Molecular weight:4,046.55 g/molEthyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2-((tert-butoxycarbonylamino)methyl)thiazole-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H18N2O4SPurity:Min. 95%Molecular weight:286.35 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molVIP (6-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP (6-28) (human, mouse, rat) trifluoroacetate salt H-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys -Lys-Tyr-Leu is a prophylactic agent that is used to prevent the development of intestinal peptide induced myocardial fibrosis. It has been shown to reduce the incidence and severity of cardiovascular diseases. VIP (6/28) has a vasoactive effect on the intestines and may also have an effect on the cardiovascular system.</p>Formula:C126H207N37O34SPurity:Min. 95%Molecular weight:2,816.29 g/mol2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt
CAS:<p>2-Hydroxy-3-mercapto-1-propanesulfonic acid sodium salt (2HMP) is a diagnostic agent that can be used for the detection of bacterial infections. The conformational properties of 2HMP are similar to those of ATP, which allows it to bind to the polymerase chain reaction enzyme and initiate an enzymatic reaction. This leads to the production of a signal that can be detected by spectrophotometry or fluorometry. 2HMP has also been shown to have chemokine activity in vitro, but this has not been tested in vivo. 2HMP is a competitive inhibitor of human protein serine proteases, such as trypsin and chymotrypsin, with an IC50 value of approximately 1 μM.</p>Formula:C3H7NaO4S2Purity:Min. 95%Molecular weight:194.2 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS:<p>Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.</p>Formula:C45H79N11O15Purity:Min. 95%Molecular weight:1,014.17 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:<p>Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).</p>Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/mol
