
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>Formula:C186H275N51O59Purity:Min. 95%Molecular weight:4,169.48 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H82N14O12Purity:Min. 95%Molecular weight:1,167.36 g/molAmyloid β-Protein (25-35) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Formula:C45H81N13O14SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,060.27 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H43N5O8Purity:Min. 95%Molecular weight:637.72 g/molPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
CAS:<p>Pancreastatin is a cytosolic protein that inhibits the production of peptide hormones such as glucagon, insulin, and gastrin. It is used to treat bowel disease, including carcinoid syndrome and inflammatory bowel disease. Pancreastatin has been shown to inhibit the activity of cyclase enzymes that are responsible for the production of these hormones. Pancreatic beta-cells produce pancreatic polypeptide (PP), which is converted by pancreastatin into inactive PP2. Pancreatic alpha-cells produce somatostatin (SS), which is converted by pancreastatin into inactive SS2. Pancreatic delta cells produce pancreatic polypeptide (PP), which is not affected by pancreastatin. Pancreatic somatostatinomas secrete SS, which is not affected by pancreastatin.</p>Formula:C214H330N68O76SPurity:Min. 95%Molecular weight:5,103.39 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H79N13O12Purity:Min. 95%Molecular weight:1,210.38 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H176N32O32SPurity:Min. 95%Molecular weight:2,574.91 g/molpTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C207H334N66O58Purity:Min. 95%Molecular weight:4,675.28 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/mol2,2'-Biphenyldicarboxylic acid anhydride - 70%
CAS:<p>2,2'-Biphenyldicarboxylic acid anhydride is a diphenic anhydride that has a carboxylate group on one end and a phenyl group on the other. The nitrogen atoms in this molecule are part of the intramolecular hydrogen bonds that stabilize the molecule. 2,2'-Biphenyldicarboxylic acid anhydride is used in wastewater treatment as it reacts with amines to form ammonium salts. This process also releases hydrogen, which can be used for fuel cells or light emission. It is also used to produce other compounds such as malonic acid and phenylacetic acid.</p>Formula:C14H8O3Purity:(%) Min. 70%Color and Shape:Brown Beige PowderMolecular weight:224.21 g/mol3-Fluorophenyl boronic acid
CAS:<p>Please enquire for more information about 3-Fluorophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6BFO2Purity:Min. 95%Color and Shape:PowderMolecular weight:139.92 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21BO3Purity:Min. 95%Molecular weight:248.13 g/molH-Arg-Ala-OH acetate salt
CAS:<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>Formula:C9H19N5O3Purity:Min. 95%Molecular weight:245.28 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H78N14O19Purity:Min. 95%Molecular weight:1,179.24 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS:<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>Formula:C9H8BrClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:263.52 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol3-Hydroxy-3-methylglutaric acid
CAS:<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formula:C6H10O5Purity:Min. 95%Molecular weight:162.14 g/molOvokinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/mol1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H26N2O4Purity:Min. 95%Molecular weight:334.41 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molMagnesium acetate anhydrous
CAS:<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>Formula:C4H6MgO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:142.39 g/molLys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>Formula:C47H75N13O11Purity:Min. 95%Molecular weight:998.18 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H38N6O5Purity:Min. 95%Molecular weight:526.63 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/mol2-Bromo-2'-chlorophenyl acetic acid methyl ester
CAS:<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>Formula:C9H8BrClO2Purity:Min. 95%Molecular weight:263.52 g/molAPL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/mol(2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester
CAS:<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O7Purity:Min. 95%Molecular weight:493.47 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formula:C61H110N24O14Purity:Min. 95%Molecular weight:1,403.68 g/molRANTES (human) trifluoroacetate salt
<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C350H534N96O100S5Purity:Min. 95%Molecular weight:7,846.9 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H224N46O47S9Purity:Min. 95%Molecular weight:3,676.23 g/mol3,5-di-tert-Butyl-4-hydroxyphenylpropionic acid methyl ester
CAS:<p>3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is a compound that has been used as an analytical reagent and as a precursor to other chemicals. It is a white solid with a melting point of about 40°C. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester is soluble in hexane, benzene, and diethylether. It also reacts with fatty acids to produce polymers. 3,5-di-tert-butyl-4-hydroxyphenylpropionic acid methyl ester has been shown to be an effective antibacterial agent against Gram negative bacteria such as Escherichia coli and Pseudomonas aeruginosa.</p>Formula:C18H28O3Purity:90%Color and Shape:Off-White PowderMolecular weight:292.41 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N7O6·C2H4O2Purity:Min. 95%Molecular weight:677.75 g/molH-Trp-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>H-Trp-Nle-Arg-Phe-NH2 acetate salt is a muscle relaxant that binds to the muscle receptor site, which is responsible for contraction of skeletal muscles. It has been shown to be effective in treating anterior retractor mytilus in horses.</p>Formula:C32H45N9O4Purity:Min. 95%Molecular weight:619.76 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H293N53O48S2Purity:Min. 95%Molecular weight:4,007.69 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H46N10O7Purity:Min. 95%Molecular weight:646.74 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H97N17O18SPurity:Min. 95%Molecular weight:1,532.72 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/molZ-Val-Lys-Met-AMC acetate salt
CAS:<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/mol(Asp56)-pTH (1-84) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp56)-pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C405H668N122O126S3Purity:Min. 95%Molecular weight:9,358.58 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H73N11O16SPurity:Min. 95%Molecular weight:1,080.21 g/mol2-Hydroxy-4-(methylthio)butanoic acid
CAS:<p>2-Hydroxy-4-(methylthio)butanoic acid (2HMB) is an amide that is used as a microbial metabolism inhibitor, especially for the inhibition of bacterial growth. 2HMB and its analogues are also used in plant physiology. 2HMB has been shown to have transport properties and can be used as an inorganic acid for the manufacture of hydrochloric acid. It has been found to have enzyme activities, such as polymerase chain reaction and hydroxyl group transferases, which make it a useful catalyst for reactions involving organic compounds. The hydroxyl group in 2HMB makes it a good candidate for use in fatty acid synthesis and oxidation reactions. Chronic exposure to this chemical may lead to carbonyl oxygen formation.</p>Formula:C5H10O3SPurity:Min. 95%Color and Shape:Yellow PowderMolecular weight:150.2 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:<p>3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.</p>Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Formula:C7H8N2O2·xHClPurity:(%) Min. 60%Color and Shape:PowderMolecular weight:188.61 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/mol1-Acetylpiperidine-4-carboxylic acid
CAS:<p>1-Acetylpiperidine-4-carboxylic acid (ACPC) is a synthetic compound that has been shown to be a potent inhibitor of the neurokinin-1 receptor. ACPC has been shown to have anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. It has also been shown to have antipsychotic effects and could be an effective treatment for psychotic disorders. The pharmacophore of ACPC is based on the cyclohexane ring and piperidine moieties, which are thought to provide affinity for the neurokinin-1 receptor.</p>Formula:C8H13NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:171.19 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H54N10O9Purity:Min. 95%Molecular weight:782.89 g/molC3a (70-77)
CAS:<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/mol4-Bromobutyl acetate
CAS:<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS:<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formula:C20H14O4Purity:Min. 95%Molecular weight:318.32 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS:<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>Formula:C150H222N44O38S6Purity:Min. 95%Molecular weight:3,442.04 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/molBenzopyrazine-6-boronic acidHCl
CAS:<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H8BClN2O2Purity:Min. 95%Molecular weight:210.43 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H293N55O68S2Purity:Min. 95%Molecular weight:4,499.82 g/molAminocaproic acid
CAS:<p>Aminocaproic acid is a non-specific lysing agent that is used in the treatment of acute blood clots. Aminocaproic acid has minimal toxicity and low-dose effects, and can be used for the treatment of thrombotic disorders. It also has biological properties that are different from those of aminocaproate, which can lead to a more rapid dissolution of the clot. Aminocaproic acid is an organic compound that belongs to the class of dicarboxylic acids. It is synthesized from two molecules of aminoacetic acid by the enzyme aminocaproic acid synthetase. The synthesis occurs in a two-step process: first, caprylic acid reacts with ATP to form aminopropyl-adenylate (APA), followed by hydrolysis by APA lyase to form aminocaproic acid.</p>Formula:C6H13NO2Color and Shape:PowderMolecular weight:131.17 g/mol3,4,5-Trichlorobenzoic acid
CAS:<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END></p>Purity:Min. 95%Ac-Gly-Ala-Lys-AMC trifluoroacetate salt
<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS:<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40FN3O6SPurity:Min. 95%Molecular weight:577.71 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molOxindole-4-boronic acid, pinacol ester
CAS:<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18BNO3Purity:Min. 95%Molecular weight:259.11 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/molγ3-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H188N44O37SPurity:Min. 95%Molecular weight:2,943.18 g/molBNP-32 (porcine) trifluoroacetate salt
CAS:<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>Formula:C149H250N52O44S3Purity:Min. 95%Molecular weight:3,570.1 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molMca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H83N19O12Purity:Min. 95%Molecular weight:1,166.34 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS:<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H20N4O5Purity:Min. 95%Molecular weight:336.34 g/molAmyloid β-Protein (1-11) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N16O22Purity:Min. 95%Molecular weight:1,325.3 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/mol4-(Dodecyloxy)benzoic Acid
CAS:<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>Purity:Min. 95%H-Gly-Gly-Arg-anilide acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H25N7O3Purity:Min. 95%Molecular weight:363.42 g/molD-Lactic acid benzyl ester
CAS:<p>D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/mol4-Hydroxyphenylboronic acid
CAS:<p>4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.</p>Formula:C6H7BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:137.93 g/molEthylenediaminetetraacetic acid tripotassium salt dihydrate
CAS:<p>Ethylenediaminetetraacetic acid tripotassium salt dihydrate is an anticoagulant that can be used as a coagulant for blood samples. It is often used in polymerase chain reactions to synthesize DNA, or to isolate and purify genomic DNA. This compound has ferroelectric properties and can be used as a target cell in optical imaging applications. Ethylenediaminetetraacetic acid tripotassium salt dihydrate is also used in the production of polyurethanes and as a polymerization inhibitor in cinnamon oil.</p>Formula:C10H13K3N2O8·2H2OPurity:Min. 95%Molecular weight:442.54 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/molpTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C414H672N122O128S2Purity:Min. 95%Molecular weight:9,470.64 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/mol(Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H76N14O11Purity:Min. 95%Molecular weight:1,097.27 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Formula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molAbz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H48N12O12Purity:Min. 95%Molecular weight:828.83 g/molMethyl 2,2-difluoro-2-(fluorosulfonyl)acetate
CAS:<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>Formula:C3H3F3O4SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:192.11 g/molFibronectin Adhesion-Promoting Peptide trifluoroacetate salt
CAS:<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>Formula:C47H74N16O10Purity:Min. 95%Molecular weight:1,023.19 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N8O5Purity:Min. 95%Molecular weight:540.61 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Formula:C30H46N10O6•C2HF3O2Purity:Min. 96 Area-%Color and Shape:PowderMolecular weight:756.77 g/molPresenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C92H130N28O37SPurity:Min. 95%Molecular weight:2,252.25 g/molGlucagon (19-29) (human, rat, porcine) trifluoroacetate salt
CAS:<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>Formula:C61H89N15O18SPurity:Min. 95%Molecular weight:1,352.52 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H170N30O40SPurity:Min. 95%Molecular weight:2,656.84 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>Formula:C190H287N55O57Purity:Min. 95%Molecular weight:4,253.65 g/molBig Endothelin-3 (22-41) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C102H156N30O31Purity:Min. 95%Molecular weight:2,298.51 g/mol(Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt
<p>Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C177H276N46O45Purity:Min. 95%Molecular weight:3,768.37 g/molβ-Casomorphin (1-3) amide acetate salt
CAS:<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>Formula:C23H28N4O4Purity:Min. 95%Molecular weight:424.49 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H89N17O17Purity:Min. 95%Molecular weight:1,332.46 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H128N32O20Purity:Min. 95%Molecular weight:1,918.13 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molMethyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate
CAS:<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>Formula:C11H10O3Purity:Min. 95%Molecular weight:190.2 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molDi-tert-butyl azodicarboxylate
CAS:<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>Formula:C10H18N2O4Purity:Min. 98%Color and Shape:PowderMolecular weight:230.26 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H81N13O14SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,060.27 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:<p>Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.</p>Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/molSperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/mol3-Acetyl-α-boswellic acid
CAS:<p>3-Acetyl-alpha-boswellic acid is a compound that has been derived from the plant Boswellia serrata. It has been shown to have antiinflammatory properties and may have clinical potential as an agent for the treatment of inflammatory diseases. 3-Acetyl-alpha-boswellic acid was found to inhibit the proliferation of myeloid leukemia cells, which were activated by cytokine stimulation. This compound also decreased the mitochondrial membrane potential in hl-60 cells, inhibited the plasma concentrations of proinflammatory cytokines, and had a two-way crossover study with healthy volunteers. In addition, it inhibits the production of 11-keto-beta-boswellic acid (KBA), which is a metabolite of 3AB that is associated with cancer progression. The antiinflammatory effects of 3AB are due to its ability to inhibit NFκB activation and downregulate IL1β and TNFα expression in leukemic cells.</p>Formula:C32H50O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:498.74 g/mol3-Bromobenzoic acid
CAS:<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>Formula:C7H5BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:201.02 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molAmyloid β-Protein (40-1) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molGalanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H210N42O43Purity:Min. 95%Molecular weight:3,157.41 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H228N38O51Purity:Min. 95%Molecular weight:3,259.53 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molpTH (28-48) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H150N28O29Purity:Min. 95%Molecular weight:2,148.38 g/mol1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H74N10O14SPurity:Min. 95%Molecular weight:1,035.22 g/molH-Thr-Lys-Pro-Pro-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H47N9O7Purity:Min. 95%Molecular weight:597.71 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molN,N'-Dibenzylethylenediamine diacetate
CAS:Controlled Product<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS:<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formula:C16H16N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:332.31 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O59SPurity:Min. 95%Molecular weight:4,345.81 g/molBIM-23627 trifluoroacetate salt
CAS:<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H69ClN12O8S2Purity:Min. 95%Molecular weight:1,161.83 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formula:C2H2O4•(H2O)2Purity:Min. 95%Molecular weight:126.07 g/molAmyloid β-Protein (1-24) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H183N35O40Purity:Min. 95%Molecular weight:2,876.06 g/molCGRP (chicken) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C165H262N52O50S2Purity:Min. 95%Molecular weight:3,838.3 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H234N46O52Purity:Min. 95%Molecular weight:3,465.7 g/mol2-Nitrobenzaldiacetate
CAS:<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/mol2,7-Naphthalenedisulfonic acid disodium salt
CAS:<p>2,7-Naphthalenedisulfonic acid disodium salt is a heteronuclear molecule that is synthesized by the reaction of 2,7-naphthalenedisulfonyl chloride with sodium sulfite in water. It has been used in the manufacture of dyes and pigments, as a corrosion inhibitor for steel and aluminum, and as an intermediate in the synthesis of pharmaceuticals. The compound has been detected in groundwater samples at concentrations up to 10 mg/L. The compound is also found in geothermal waters at concentrations up to 0.6 mg/L.</p>Formula:C10H6Na2O6S2Purity:Min. 95%Molecular weight:332.26 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/mol4-Nitro benzenebutanoic acid
CAS:<p>4-Nitro benzenebutanoic acid is a synthetic molecule that has not been extensively studied in biological systems. It is a calcium-binding molecule and may be used to study the mechanisms of calcium binding. 4-Nitrobenzenebutanoic acid has also shown some bifunctional activity and is used as a substrate in pharmacokinetic studies. The synthesis of this compound can be achieved by reacting azobenzene with butyric acid in the presence of an amine and inulin. This reaction produces nitrobenzenebutanoic acid, which undergoes hydrolysis to yield 4-nitrobenzenebutanoic acid.</p>Formula:C10H11NO4Purity:Min. 95%Molecular weight:209.2 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molNeuropeptide VF (56-92) (human) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H304N52O51S2Purity:Min. 95%Molecular weight:4,256.95 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37Purity:Min. 95%Molecular weight:2,763.07 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H281N57O54S2Purity:Min. 95%Molecular weight:4,207.67 g/mol5-Formyltetrahydropteroic acid
CAS:<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>Formula:C15H16N6O4Purity:Min. 95%Molecular weight:344.33 g/mol(2S)-β-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS:Controlled Product<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formula:C21H33N5O5Purity:Min. 95%Molecular weight:435.52 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H22N4O5·C2HF3O2Purity:Min. 95%Color and Shape:SolidMolecular weight:440.37 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/mol(Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp3,Arg5)-Ghrelin (1-5) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O7Purity:Min. 95%Molecular weight:651.71 g/molBz-Ile-Glu-Gly-Arg-pNA acetate salt
CAS:<p>Bz-Ile-Glu-Gly-Arg-pNA acetate salt is an anticoagulant that binds to heparin. It has been shown to inhibit protease activity in soybean trypsin by binding to the active site of the enzyme. Bz-Ile-Glu-Gly-Arg-pNA acetate salt has also been shown to have a molecular weight of heparin and a protein synthesis inhibition rate of fibrinogen, which is responsible for coagulation.</p>Formula:C32H43N9O9Purity:Min. 95%Molecular weight:697.74 g/molPACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H300N56O45SPurity:Min. 95%Molecular weight:4,024.75 g/mol(d(CH2)51,Tyr(Me)2,Thr4, Orn 8,Tyr-NH29)-Vasotocin trifluoroacetate salt
CAS:<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br>br><br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>Formula:C54H79N11O13S2Purity:Min. 95%Molecular weight:1,154.4 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS:<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H15BrO4S•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:329.21 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molBz-Val-Gly-Arg-AMC trifluoroacetate salt
CAS:<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>Formula:C30H37N7O6Purity:Min. 95%Molecular weight:591.66 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/mol(4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid
CAS:<p>Please enquire for more information about (4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H21NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:403.43 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molBiotinyl-Hepcidin-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H184N36O33S10Purity:Min. 95%Molecular weight:3,015.66 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H85N19O13Purity:Min. 95%Molecular weight:1,208.37 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molBNP-32 (rat) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C146H239N47O44S3Purity:Min. 95%Molecular weight:3,452.95 g/molEthyl imidazole-2-carboxylate
CAS:<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>Purity:Min. 95%Hel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molUndecanoic acid
CAS:<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>Formula:C11H22O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.29 g/mol(D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt
CAS:<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>Formula:C29H41N5O7SPurity:Min. 95%Molecular weight:603.73 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O58SPurity:Min. 95%Molecular weight:4,272.67 g/mol3,4-Dibromobenzoic acid ethyl ester
CAS:<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>Formula:C9H8Br2O2Purity:Min. 95%Molecular weight:307.97 g/molLithium acetoacetate
CAS:<p>Lithium acetoacetate is a compound that is used in the treatment of cancer. It is a salt that contains lithium and acetoacetate. Lithium acetoacetate has been shown to be clinically relevant for the treatment of cancer, particularly in patients who have not responded well to other treatments. This drug has also been shown to induce apoptosis in animal cells, which may be due to its ability to produce acid.</p>Formula:C4H6O3•LiPurity:Min. 95%Color and Shape:PowderMolecular weight:109.03 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/molBiotinyl-epsilonAhx-ω-Conotoxin GVIA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H207N41O46S7Purity:Min. 95%Molecular weight:3,376.81 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/molH-DL-Val-Leu-Arg-pNA acetate salt
CAS:<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>Formula:C23H38N8O5Purity:Min. 95%Molecular weight:506.6 g/mol(Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Acm)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C169H279N53O51S2Purity:Min. 95%Molecular weight:3,933.48 g/mol
