Amino Acids (AA)

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>

<p>Please enquire for more information about H-Arg(NO2)-OBzl p-tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>

<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-Leu-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>

<p>N-Tritylglycine is an acidic amino acid that can be protonated in a highly acidic environment. It has been shown to inhibit the growth of tumor tissue by inducing apoptosis and inhibiting protein synthesis. N-Tritylglycine is used as a reagent for analytical chemistry, where it is used to detect amines such as histamine and serotonin. N-Tritylglycine also has been shown to be potent inhibitor of kinesin.</p>

<p>Please enquire for more information about Boc-Asp(OcHex)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Ac-Leu-Val-Phe-aldehyde is a synthetic compound that inhibits the catalytic activity of carboxyl enzymes. It binds to the catalytic site of the enzyme via a noncovalent interaction with residues on the polypeptide chain, thereby preventing the formation of an active complex with other cofactors such as metal ions, amino acids, and ATP. Ac-Leu-Val-Phe-aldehyde can be used in analytical chemistry for determination of carboxyl groups in organic compounds or for determining protein content in biological samples. Ac-Leu-Val-Phe-aldehyde has also been shown to bind to antibodies which are specific for carboxyl groups.</p>

<p>Ac-Glu-pNA is a synthetic substrate that is used in protease assays. Its amino acid sequence contains reactive groups, such as the carboxy terminal, that are cleaved by proteases. Ac-Glu-pNA has been shown to be a good substrate for thermophilic and licheniformis proteases and has been reported to be stable at neutral pH values.</p>

<p>Please enquire for more information about H-Asp-Ala-His-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-L-isoleucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Leu-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-N-methyl-L-leucine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine L-malate is a chemical compound that is used in wastewater treatment. It inhibits the activity of enzymes such as carbon disulphide oxidase, copper complexes, and cationic surfactants. L-Lysine L-malate can be synthesized from sodium citrate and malonic acid by reacting with hydrogen peroxide to form a bicyclic heterocycle. This compound has been shown to have biological effects on metabolic disorders in animal studies, which may be due to its ability to inhibit the synthesis of fatty acids and proteins. The adsorption mechanism for this product is unknown.</p>

<p>Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Gly-Gly-Phe-pNA is a colorimetric substrate for Chymotrypsin and Streptomyces griseus protease B. Activity is quantified by the release of p-nitroaniline which is measured by absorbance at 405 nm.</p>

<p>2-Isobutyl-3-methoxypyrazine is a hydrophobic compound that is not soluble in water. It has a bound form and can be titrated with calorimetry. 2-Isobutyl-3-methoxypyrazine is synthesized by reacting 2,2,4-trimethylpentane with methoxyacetone in the presence of sodium methylate. The compound has been detected as an odorant in numerous plant species and is believed to play a role in plant physiology. 2-Isobutyl-3-methoxypyrazine has been shown to have potent antiviral activity against infectious diseases such as HIV, herpes simplex virus type 1 (HSV1), and varicella zoster virus (VZV). This specific antiviral activity may be due to its ability to bind fatty acids by hydrogen bonds, which may interfere with the synthesis of viral membranes.</p>

<p>H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn is a cytosolic protein that is an inhibitor of protein synthesis. It has been shown to inhibit the activity of proteases, such as caspase 1, and to activate caspase 1. This inhibition is consequent to the inhibition of polypeptide chain elongation and may be due to the ability of HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH to bind to peptidyl transferase or other proteins involved in protein synthesis. HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH binds to primary keratinocytes and k562 cells more efficiently than it does to thp1 cells, suggesting that it may have a role in skin cancer.</p>

<p>Please enquire for more information about Boc-Thr(Bzl)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Acetyl-1-methylpyrrole is an activating agent that can be used to synthesize methyl ketones. It has been shown to react with acid solutions and proton, which are generated by the reaction of a metal ion (such as Al) with hydrochloric acid. This reaction leads to the formation of enolate ions, which can then react with carbonyl groups to form alkylation products. 3-Acetyl-1-methylpyrrole is also able to catalyze reactions in both acidic and basic conditions. The kinetic of this reaction is fast, efficient, and does not require expensive equipment.</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>H-Gly-Phe-Leu-OH is a hydrophobic amino acid and homologue of the natural amino acid histidine. It is an organic compound that is used in the synthesis of peptides and proteins. This compound can be synthesized by reacting ethyl esters with glycine, phenylalanine, and leucine. H-Gly-Phe-Leu-OH has been shown to be active against organisms such as Staphylococcus aureus, Escherichia coli, and Bacillus subtilis. The effectiveness of this compound may be due to its ability to bind to various sites on the organism's cell wall. It also has been shown to have antiplatelet activity similar to aspirin.</p>

<p>C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.</p>

<p>Please enquire for more information about Z-Phe-Arg-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>

<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Tyr-Leu-OH is a molecule that contains a pyrrolidine ring and methyl groups. The molecule is an amino acid, which is one of the twenty that are used to form proteins. It has three terminal residues, which are H, Leu, and Tyr. The crystallographic structure of the compound was determined by x-ray crystallographic studies and it was found to be orthorhombic with a sephadex crystal lattice. The molecular conformation of this compound can be altered through kinetic or equilibrium processes.</p>

<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>

<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>

<p>Vasopressin is a hormone that is released from the posterior pituitary gland and stimulates the release of water from the kidneys. Vasopressin binds to receptors in the kidney tubules and increases water permeability and urine volume. Vasopressin also has been shown to be effective in reducing sensitivity to ionizing radiation, which may be due to its ability to bind with sulfur-containing amino acids such as cysteine and glutathione. The radiolabeled form of vasopressin is used as a tracer for measuring lung function, including volumes of air flow, gas density, and gas volume.</p>

<p>Please enquire for more information about 2-Methyl-5-chloromethylpyridineHydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Cys(Acm)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>

<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>

<p>The HCV-1 e2 protein (484-499) is a peptide that is a fragment of the HCV-1 e2 protein. It has been shown to be neuroprotective in vitro and in vivo, by inhibiting the production of reactive oxygen species and reducing cell death. The HCV-1 e2 protein (484-499) is also able to inhibit inflammatory responses in human pancreatic cells and fibrosis in autoimmune disease models. This peptide could be used as prophylaxis or treatment for neurodegenerative disease, pancreatic cancer, infectious diseases, autoimmune diseases, or fibrotic diseases.</p>

<p>H-Glu-bNA is a synthetic peptide that has been shown to have aminopeptidase activity. H-Glu-bNA has been used as a marker for the presence of proteolytic bacteria in milk and cheese products. The enzyme hydrolyzes peptides at the carboxyl terminal end of amino acids, releasing them from protein molecules. It is also used to study the action of proteases on casein, which are enzymes that break down the proteins found in milk. The enzyme can be assayed in vitro using lactococci or other bacterial cells. This product is not intended for use as an antibiotic or antimicrobial agent and should not be taken internally.</p>

<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>

<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-2-aminoacetaldehyde is an aliphatic aldehyde that has been used in the synthesis of a number of bioactive molecules. It is synthesized by reacting an N-Boc amino acid with chloroform and hydrochloric acid. The reaction time is typically 2 hours at room temperature, although it can be decreased to 20 minutes if the temperature is increased to 60°C. The product can be purified using extraction or recrystallization methods. N-Boc-2-aminoacetaldehyde reacts with chloride ions to form phosphoranes, which are useful in clinical development as antimicrobial peptides. This compound also reacts with fluorine to form hydrogenated derivatives that have been shown to have neurokinin activity in animal models.</p>

<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Gly-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cholecystokinin Octapeptide (1-4) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>

<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>

<p>N-alpha-Fmoc-N-delta-Boc-D-ornithine (NFDO) is an antibiotic that belongs to the group of macrocyclic, cyclic antibiotics. This drug has antibacterial activity against gram-negative pathogens and is most effective against E. coli. NFDO is synthesized by a solid phase synthesis that occurs in two stages: first, FMOC protected amino acids are coupled to the resin and then deprotection is carried out with piperidine in DMF at room temperature. The final product is obtained by cleavage of the peptide from the resin with trifluoroacetic acid and purification by HPLC.</p>

<p>Please enquire for more information about (Des-octanoyl)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>

<p>Please enquire for more information about Fmoc-Gly-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>

<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>

<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>

<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>