Amino Acids (AA)

<p>Please enquire for more information about H-Gly-Pro-Leu-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human CMV Assemblin Protease Inhibitor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phacolysine sodium salt is a drug that activates the choroidal neovascularization receptor. It has been shown to inhibit the growth of tumors by synchronous fluorescence and disulfide bond binding. Phacolysine sodium salt has shown clinical efficacy in the treatment of choroidal neovascularization, with an average success rate of 75%. It has also been shown to be effective in treating other types of cancer, such as prostate cancer. In addition, it has antioxidative properties and can inhibit prostaglandin synthesis. This medicine is sometimes used in combination with ondansetron hydrochloride and benzalkonium chloride for pharmacological treatment.</p>

<p>H-beta-Ala-Phe-OH is a synthetic dipeptide that is positioned at the C terminus of the l-phenylalanine residue. It has two residues, H and beta-Ala, which are connected by a peptide bond between the carboxyl group of beta-Ala and the amino group of phenylalanine. The crystallographic structure of this molecule shows that it adopts a helical conformation with hydrogen bonds between adjacent helices. This water-soluble molecule has been shown to have antihypertensive properties in animal studies.</p>

<p>H-Cys-pNA is a labile molecule that has been used as a substrate for aminopeptidase activity. It is a competitive inhibitor of aminopeptidase and binds to the active site of the enzyme, preventing it from cleaving peptides from their amino acids. H-Cys-pNA has been shown to inhibit oxytocin release by binding to the oxytocin receptor in rat brain tissue. This molecule also inhibits the growth of dysgerminoma cells in vitro and blocks cell division. H-Cys-pNA is susceptible to proteolytic degradation and may be degraded by polyacrylamide gel electrophoresis, which can be used for its analysis on polyacrylamide gels.</p>

<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>

<p>N-Me-Thr(Bzl)-OH·HCl is a soluble, hydroformylation catalyst with alkenyl and sulfonated substituents. It is used as a hydrogenation catalyst in the industrial production of polymers, detergents, and other organic chemicals. It can also be used to catalyze the reduction of carbonyl groups to alcohols in organic synthesis.<br>N-Me-Thr(Bzl)-OH·HCl is insoluble in water and can be converted into an insoluble form by reacting with HCl or NaOH. This product has been shown to have radical properties that allow it to catalyze the hydrogenation of alkenes and alkynes.</p>

<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-D-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>

<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>

<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>

<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Met-Lys-Bradykinin is a synthetic peptide with the amino acid sequence Met-Lys-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg. It has been shown to have cytosolic Ca2+ release activity, protease activity, and vasodilator activities. The peptide also has binding affinity for human immunoglobulin G (IgG) and is able to form complexes with soybean trypsin.</p>

<p>H-Phe-Leu-Glu-Glu-Val-OH is a synthetic amino acid molecule that is used as a substrate for protein synthesis. The solubilized and biochemically active H-Phe-Leu-Glu-Glu-Val-OH can be prepared by the reaction of glutamic acid with phenylalanine, leucine, and glycine. This product is an irreversible enzyme that has been conjugated to a linker to form a reversible linkage. A spectrometer can be used to analyze the chemical structure of this compound. It is soluble in water and has a molecular weight of 310. It contains two carboxyl groups and one amino group that are linked by amide bonds.</p>

<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>

<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurotensin (NT) is a peptide that has been implicated in the regulation of feeding behavior, cardiovascular function, and pain perception. The neurotensin receptor is a G-protein coupled receptor with seven transmembrane domains. Neurotensin binds to the receptor and activates it by inducing intracellular calcium mobilization and neurotransmitter release. This activation can be dose-dependent, as seen in experiments using rat brain slices incubated with different concentrations of NT. Neurotensin also induces maximal activation at low concentrations, which may be due to its ability to bind to both extracellular and intracellular receptors. NT binds selectively to ventral tegmental area neurons from rats, leading to increased spontaneous firing rates. Cancer cells have been shown to express high levels of neurotensin receptors on their surface membrane, which may contribute to tumorigenesis and metastasis. Neurodegenerative diseases such as Alzheimer’s disease are thought to involve alterations in the expression or</p>

<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclosporine is a cyclic peptide that is used as an immunosuppressive drug. It binds to the cytosolic protein phosphatase, preventing its activation. Cyclosporine also binds to other proteins in the cell, such as casein kinase II and cyclophilin, leading to changes in cellular function. It has been shown to inhibit the production of cytokines and other inflammatory mediators by inhibiting tyrosine kinase activity. Cyclosporine is metabolized into FK506, which has a similar structure but greater potency than cyclosporine. The mechanism of action for FK506 is not fully understood but it appears to be related to its ability to bind to tyrosine kinases and inhibit their activity.</p>

<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Histatin-8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>

<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>

<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Phe-Pro-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Pro-Leu-Gly-OH is a synthetic peptide that has been shown to be an effective crosslinker for thiols. Ac-Pro-Leu-Gly-OH is a water soluble, acidic peptide and can be used in biological systems as a crosslinker.</p>

<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>

<p>Ranamargarin H-Asp-Asp-Ala-Ser-Asp-Arg-Ala-Lys-Lys-Phe-Tyr-Gly-Leu-Met-NH2 is a compound that has been shown to bind to the dopamine receptor in rats. It has been shown to have low potency and is not active in clinical trials. Ranamargarin H-Asp-Asp-Ala-Ser--Asp--Arg--Ala--Lys--Lys--Phe--Tyr--Gly--Leu---Met---NH2 has also been shown to inhibit the production of dopamine in animals and humans, with a maximal response at concentrations of 10 nM. The biological properties of this compound are still being researched, but it appears that it can be used as a lead for developing new drugs for treating Parkinson's disease.</p>

<p>Substance P is a neuropeptide that is found in the brain and throughout the peripheral nervous system. It has been found to be involved in numerous physiological processes, including pain transmission, vasodilation, and inflammation. Substance P binds to neurokinin-1 receptor (NK-1R) with high affinity. NK-1R has been shown to be localized on cells of the submandibular gland and salivary gland. Techniques such as binding experiments have shown that substance P binds to NK-1R with high affinity and is therefore likely involved in salivation and other functions of these glands.</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>

<p>Please enquire for more information about Boc-Thr(Gly-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-glu-OAll is a cyclic peptide that is synthesized using solid-phase synthesis. It has been shown to have minimal inhibitory concentration (MIC) values of 0.5 µg/mL against mouse tumor cells and human serum, as well as high affinity for integrin receptors. This peptide also binds to the human serum albumin and blood clotting factor Xa, which are proteins involved in cancer therapy.</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br&gt;br&gt;br&gt;</p>

<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys8·13)-Dynorphin A (1-13) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Arg(Mtr)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Met-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>

<p>Please enquire for more information about N-Me-D-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>

<p>Z-Ala-Pro-OH is a synthetic, analog substrate for serine proteases. It is used as a target cell for schistosomiasis, which are parasitic worms that infect humans and cause the disease. The molecule is localized in the digestive tract of the parasite, where it has biochemical properties that are analogous to those found in the natural substrate (serine protease) of this organism. Z-Ala-Pro-OH has been shown to inhibit the growth of various species of schistosomes, including Schistosoma mansoni. It also has immunoregulatory properties and can be used to stimulate antibody production by B cells when combined with an antigen.</p>

<p>Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 is an analog of dynorphin A. It is a peptide that has been shown to be effective in reducing blood pressure and stress levels in animals. Dynorphin A (1-10) amide H-Tyr-Gly-Gly-Phe-Leu-Arg - Arg - Ile - Arg - Pro - NH2 also has analgesic properties and may be useful for the treatment of cardiac diseases.</p>

<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>

<p>BQ-610 is a novel peptide that has been shown to reduce the severity of mucosal inflammation in animal models of inflammatory bowel disease. It functions by binding to myofibroblasts, which are cells that produce an extracellular matrix and collagen. BQ-610 also blocks signalling pathways that are responsible for the production of TNF-α, MMP-2, and other molecules involved in the pathogenesis of inflammatory bowel disease. BQ-610 is effective at reducing inflammation in animal models of colitis, but not in human colonic epithelial cells or human colonic tissue.</p>

<p>Please enquire for more information about H-beta-Ala-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>

<p>H-Ser-Val-OH is a peptide that acts as a serotonin reuptake inhibitor. It has been shown to have antiangiogenic properties, which may be due to its ability to bind with the 5HT2A receptor and inhibit angiogenesis. H-Ser-Val-OH has also been shown to inhibit the growth of tumor cells in culture by binding to the peptide binding site on the growth factor receptor. H-Ser-Val-OH can be used for cancer therapy by increasing radiation sensitivity and inhibiting tumor perfusion.</p>

<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>

<p>Please enquire for more information about Suc-Ala-Ala-Pro-Phe-2,4-difluoroanilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-L-alpha-aminobutyric acid is a synthetic amino acid that is used as a linker in solid-phase peptide synthesis. It is also used to synthesize analogs of the serine protease NS3, which are postulated to inhibit hepatitis C virus replication by preventing the release of viral RNA from infected cells. Fmoc-L-alpha-aminobutyric acid has been shown to have anti-viral activity against the influenza virus and HIV.</p>

<p>Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a peptide that is the product of proteolytic cleavage of substance P. It binds to the neurokinin receptor and induces degranulation in mast cells and sensory neurons. It has been used as a diagnostic tool for mast cell degranulation. Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe has also been used to assess lung function in anesthetized animals, circulations in muscle, and changes in perfusion during surgical procedures.</p>

<p>H-Tyr-betaNA is a synthetic substrate that has been used to study the binding activities of natural and synthetic opioid compounds. H-Tyr-betaNA binds to δ opioid receptors and inhibits the release of neurotransmitters such as acetylcholine, histamine, and serotonin. It also binds to δ-opioid receptors, which are involved in mediating pain responses. This compound has been shown to be an inhibitor of antinociceptive responses in rats, but it is not yet known whether it can cross the blood brain barrier. The pharmacokinetic properties of H-Tyr-betaNA have not been fully elucidated; however, it has been shown to be stable at neutral ph.</p>

<p>Please enquire for more information about 2-Hydroxy-5-methoxybenzimidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Histogranin H is a glycoprotein that is secreted by gland cells. Histogranin H has been shown to have pharmacological effects on locomotor activity and pain in animal models. This protein has also been shown to inhibit cancer growth in vitro and in vivo. In addition, it has a protective effect on the central nervous system, which may be due to its ability to increase the expression of brain-derived neurotrophic factor (BDNF). It also inhibits the proliferation of glioma cells, which are cancerous tumors that originate from glial cells in the brain. Histogranin H binds to histone proteins and glutamate receptors, which leads to an antinociceptive effect when injected into rats. The antinociceptive effect of this protein is attenuated by trypsin treatment. Histogranin H has also been shown to have an analgesic effect when injected into rats with chronic pain models.</p>

<p>Please enquire for more information about Ac-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.</p>

<p>Please enquire for more information about Fmoc-4-methoxy-4'-(gamma-carboxypropyloxy)-benzhydrylamine linked to Alanyl-aminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Gly-Nva-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Phe-NH2·HCl is a peptide that has been shown to have antiviral and anticancer properties. It blocks the replication of viruses by interacting with the amino acid sequence on the virus’s outer layer, which prevents the virus from binding to cells. H-Leu-Phe-NH2·HCl has also been shown to have anticancer properties. This peptide stimulates cancer cells to produce proteins that are required for their growth and proliferation, leading to increased tumor size. The effectiveness of this drug is enhanced when combined with other cancer drugs, such as cisplatin or vinblastine. H-Leu-Phe-NH2·HCl also has an excellent safety profile and does not cause any toxicity in healthy cells or tissues.</p>

<p>Please enquire for more information about H-His(1-Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>