Amino Acids (AA)

<p>Please enquire for more information about Fmoc-a-Me-D-Asp(OtBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV Protease Substrate IV including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Glu-OH is a fatty acid that is involved in the synthesis of proteins. It is involved in the transcription-polymerase chain reaction, which is a technique used to amplify DNA sequences. H-Trp-Glu-OH is also used in sample preparation and in the treatment of neurological disorders and diabetes. H-Trp-Glu-OH has been shown to inhibit neuronal death by inhibiting uptake and cell proliferation through hydrogen bonds with human serum and peroxisome proliferation. This compound has also been shown to have diagnostic properties for diabetes, as it can be detected in human serum after an insulin stimulus.</p>

<p>H-Gly-His-OH·HCl is a methyl ester of histidine. It has an axial orientation, and the optical rotation is +25.4° (c=1 in methanol). H-Gly-His-OH·HCl is synthesized from glutamic acid, glutamate, and imidazole by using a method based on the catalytic properties of copper. H-Gly-His-OH·HCl can be used as a ligand for the enzyme peroxidase, which catalyzes oxidation reactions with hydrogen peroxide or organic peroxides to form water and oxidized products. The efficiency of this reaction increases with increasing concentrations of H-Gly-His-OH·HCl.<br>!--END--&gt;</p>

<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>

<p>Boc-glu(OtBu)-OH is a synthetic substrate that is used in chemical diversity studies. It has been shown to be an important model system for the study of disaccharide uptake and metabolism. This substrate binds to lectins, which are proteins found on the surface of cells. Boc-glu(OtBu)-OH binds to oligosaccharides and human cervical carcinoma cells, as well as amide groups. Analytical methods have been developed to measure its uptake and metabolism.</p>

<p>Please enquire for more information about Metorphamide (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tumor Targeted Pro-Apoptotic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>

<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>

<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (1-24) (human, bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-beta-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His-Lys(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Tyr-His-OH is a trifluoroacetic acid derivative that is a histidine odorant. It can be used as a substitute for histidine in the detection of blood pressure, due to its ability to bind to nitric oxide and histidine receptors. H-Tyr-His-OH has been shown to have immunological properties, and it has been used as an immunogen in the production of monoclonal antibodies against human erythrocytes. H-Tyr-His-OH is also considered to be a potential biomarker because it can be detected by LC-MS/MS methods.</p>

<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is a complex compound that is useful as a reagent for organic synthesis. It has been shown to be an effective intermediate in the synthesis of various compounds, such as peptides and pharmaceuticals. Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is also used as a building block for more complex molecules. This chemical has been shown to have high purity and quality, making it suitable for research purposes.</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2 is a synthetic peptide that inhibits the activity of cyclase enzymes. It has been shown to inhibit skin cancer cells and has been shown to bind intracellular targets, such as protein kinase C, with high affinity. G protein antagonist Pyr-Gln-D-Trp-Phe-D-Trp-D-Trp--Met--NH2 has also been shown to inhibit the guanine nucleotide binding proteins (G proteins), which are necessary for cell signaling. G protein antagonist Pyr--Gln--D--Trp--Phe--D--Trp--D---Trp---Met---NH2 may also be used as an inhibitor of neurokinin 1 receptor activation and whole cell recordings have shown this drug to be potent antagonists of α subunit. G protein antagonist Pyr--Gln--D</p>

<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>

<p>Ac-Ala-Ala-Ala-Ala-OMe is a peptidase that hydrolyzes the ester bonds of the hydrophobic amino acid residues, such as alanine, valine, leucine, and isoleucine. This enzyme deacylates and releases these amino acids from the side chain of their corresponding fatty acyl groups. Ac-Ala-Ala-Ala-Ala-OMe also acts on N terminal and C terminal residues. The presence of a scissile bond in the peptide substrate is required for this enzyme to function. Acetylation reactions are concurrent with acylation reactions, which produce an acetylated peptide product.</p>

<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>

<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about 1-Boc-5-Cyano-3-hydroxymethylindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Pro-Leu-Phe-pNA is a synthetic protease with regulatory, mycological, and proteolytic properties. It has been shown to be effective against anisopliae, nematodes, and serine proteases. Suc-Ala-Pro-Leu-Phe-pNA has been synthesized by the chemical coupling of three amino acids: alanine, proline, and phenylalanine. The sequence of this protease is SEQ ID NO:1. Suc-Ala-Pro-Leu-Phe-pNA has a pH optimum of 3.0 and exhibits significant activity at acidic pHs (less than 6). The enzyme also displays kinetic properties that are typical for serine proteases. The buffer used in the assay should be Tris or phosphate buffered saline (PBS) at pH 7.2 to 8.0 with a salt concentration of 150 mM NaCl or</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prolactin-Releasing Peptide (12-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone belongs to a group of active compounds and is a cleavage product of the caspase family. It has been shown to induce apoptosis in kidney cells by cleaving the polymeric form of the protein caspase 3, which is induced by viral infection or bacterial infection. This compound is used for coinfection with HIV and HCV. Ac-Tyr-Val-Lys(biotinyl)-Asp-2,6-dimethylbenzoyloxymethylketone can also be used for detecting apoptosis in other types of cells such as erythrocytes and neutrophils.</p>

<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (1-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-34) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>

<p>Glutamate is the most abundant amino acid in the body and plays an important role in metabolism, brain function, and immune function. It is involved in many biochemical reactions and has been found to be associated with liver lesions, thermal expansion, and brain functions. Glutamate also has a role in diseases such as Huntington's disease, amyotrophic lateral sclerosis (ALS), and Parkinson's disease. Furthermore, glutamate is used as a neurotransmitter that regulates the central nervous system. The treatment of diseases can be done through glutamate replacement therapy or by inhibiting glutamate receptors. Glutamate levels in human serum have been shown to increase when blood sampling is taken from individuals with metabolic disorders. Results show high values for glutamate levels in human serum samples collected from patients with metabolic disorders.</p>

<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Leu-Ser-Leu-Ser-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 is a synthetic peptide that binds to the opioid receptors, which are found in many areas of the body, including the brain and peripheral nervous system. Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 has been shown to bind to the mu receptor with an affinity of ˜1 nM. It has also been shown to have antiinflammatory and anticancer properties. Ac-Arg-Phe-Met-Trp-Met -Arg NH2 has also been found in some cases to be effective against neurodegenerative diseases such as Alzheimer's disease. Ac Arg Phe Met Trp Met Arg NH2 is often used as a diluent for peptides and proteins because it does not cause aggregation.</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>

<p>H-Val-Pro-Pro-OH is a peptide that has been shown to have inhibitory properties on bacterial strains such as E. coli and Staphylococcus aureus. H-Val-Pro-Pro-OH is an ester hydrochloride derivative of the amino acid Valine, which has been shown to have antihypertensive effects in mice. H-Val-Pro-Pro-OH can be used for the treatment of hypertension and other cardiovascular diseases by modifying the activity of ion channels. H-Val-Pro-Pro--OH is a peptide that inhibits the production of nitric oxide (NO) and reactive oxygen species (ROS) in endothelial cells, which are involved in physiological functions such as blood pressure control and vasodilation. The mechanism by which H--Val--Pro--Pro--OH produces these effects may involve inhibition of NO synthase (NOS) and inhibition of ROS production from NADPH oxidase 2 (N</p>

<p>Ac-Phe-Gly-pNA is a peptidyl prodrug that has been shown to have proteolytic activity against cells of the malignant phenotype. Ac-Phe-Gly-pNA is converted to an active form by serine proteases, which are found on the surface of trophozoites and in cancerous cells. The sequence of Ac-Phe-Gly-pNA is homologous with a protein found in Giardia lamblia, and it has been shown to be active against this parasite. Ac-Phe-Gly-pNA can also be detected with fluorogenic substrates and aminopeptidase activity.</p>

<p>N-Methyl-L-trans-4-hydroxyproline hydrochloride is a bioactive compound that is present in the leaves of Semecarpifolia. It has been found to have antioxidant and anti-inflammatory properties. The chemical structure of N-methyl-L-trans-4-hydroxyproline hydrochloride is cyclic, butanamide, hexane, ethanolic extracts, and semecarpifolia. The family Meliaceae includes species such as Eucalyptus, which produces the bioactive compound cineole. Solvents used in this process are hexane and ethanolic extracts.</p>

<p>Z-Phe-Ala-diazomethylketone is a molecule that belongs to the class of hydrolase inhibitors. It has been shown to have inhibitory properties against trichomonas vaginalis and proteolytic activity against liver cells. Z-Phe-Ala-diazomethylketone also has a kinetic energy of 11.2 kcal/mol, which is higher than most protease inhibitors. This molecule has been shown to be effective as a cell vaccine in wild-type mice and as a protease inhibitor in brain cells. The optimal ph for this molecule is 7.5, which corresponds to its pKa value of 5.1.</p>

<p>Please enquire for more information about Fmoc-Arg(Pmc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>

<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-His(Trt)-OH is a chemical compound that has been used in the laboratory to study uptake and binding of compounds. It is stable in complex with albumin, which has led to its use as a model system for studying hepatic steatosis. This chemical can be synthesized by solid-phase synthesis with trifluoroacetic acid and polypeptide synthesis. FT-IR spectroscopy has been used to characterize Boc-His(Trt)-OH, revealing its chemical diversity.</p>

<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>

<p>Please enquire for more information about H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu(Glu(Gln-OH)-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ala-NH2 is a peptide that has been modified. Z-Ala-Ala-NH2 is a hydrolase and has the ability to hydrolyze peptides. It can be used in organic solvents as an unmodified hydrolase, or it can be modified with a nucleophile (such as an amine) to produce an active hydrolase. The unmodified form of Z-Ala-Ala-NH2 has been shown to have high yields and specificity for peptidyl substrates. This modification is also useful for the synthesis of amide bonds in peptides, which are more stable than ester bonds.</p>

<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Methylmorpholine is a protease inhibitor that has been shown to inhibit HIV-1 protease, a class of enzymes that are involved in the replication of HIV-1. It is used as a research tool to study the structure and function of HIV-1 protease. (R)-2-Methylmorpholine binds to the active site of the enzyme by forming hydrophobic interactions with residues in the active site. This binding leads to an inhibitory effect on ligand binding, protein synthesis, and other cellular processes. Molecular modeling studies have shown that (R)-2-Methylmorpholine inhibits HIV-1 protease by blocking the catalytic cleft and preventing access to substrate residues.</p>

<p>Boc-Ala-Gly-Gly-OH is a reactive compound that can be used to synthesize antibiotics. It can be used for the production of diazide, which is an antibiotic that inhibits bacterial growth by binding to DNA and preventing its replication. Boc-Ala-Gly-Gly-OH also has been used for the preparation of urethanes, which are used as coatings for medical devices or catheters. This compound is chiral and has been shown to have stereogenic properties in catalytic asymmetric epoxidation reactions.</p>

<p>Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.</p>

<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>

<p>Please enquire for more information about Boc-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>