Peptides
Subcategories of "Peptides"
Found 29595 products of "Peptides"
PDGF beta-Receptor (739-746) (phosphorylated)
Catalogue peptide; min. 95% purityFormula:C48H62N9O18PSMolecular weight:1,116.14 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
Catalogue peptide; min. 95% purityFormula:C42H67N9O12Molecular weight:890.06 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Molecular weight:1,078.25 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
Catalogue peptide; min. 95% purityFormula:C203H331N63O53S1Molecular weight:4,534.24 g/mol[Lys8]-Vasotocin (free acid)
Catalogue peptide; min. 95% purityFormula:C43H66N12O13S2Molecular weight:1,023.21 g/molC. difficile Toxin B (192-207)
Catalogue peptide; min. 95% purityFormula:C81H136N22O29Molecular weight:1,882.12 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formula:C149H224N44O45SMolecular weight:3,383.78 g/molAmyloid beta-Protein (35-25) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C45H81N13O14SPurity:Min. 95%Color and Shape:PowderMolecular weight:1,060.27 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS:Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C72H97N17O16SPurity:Min. 95%Molecular weight:1,488.71 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurity:Min. 95%Molecular weight:910.46 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formula:C170H253N47O52Molecular weight:3,787.20 g/molPrepro-Neuromedin U (104-136) (human)
Catalogue peptide; min. 95% purityFormula:C177H277N47O45Molecular weight:3,783.47 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purity:Min. 95%Color and Shape:PowderMolecular weight:392.49 g/molPreproenkephalin B (186-204), human
Catalogue peptide; min. 95% purityFormula:C78H115N21O36SMolecular weight:1,954.97 g/molPhenylalanine-free protein 115 120 125
Catalogue peptide; min. 95% purityFormula:C85H131N21O26SMolecular weight:1,895.18 g/mol[D-His26]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purityFormula:C189H285N55O57S1Molecular weight:4,271.67 g/mol[Met5, Lys6,7] a-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purityFormula:C39H59N9O9SMolecular weight:830.02 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formula:C33H44N10O7•(HCl)xPurity:Min. 95%Molecular weight:692.77 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser-OH
CAS:Please enquire for more information about H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Tyr-Tyr-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C89H123N21O21Purity:Min. 95%Molecular weight:1,823.06 g/molH-Ala-Pro-pNA hydrochloride salt
CAS:H-Ala-Pro-pNA hydrochloride salt is a protease inhibitor that is used as a therapeutic agent for the treatment of hepatitis C. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, by binding to their active site. H-Ala-Pro-pNA hydrochloride salt also inhibits the activity of DPPIV (dipeptidyl peptidase IV), which is an enzyme that cleaves the third amino acid from peptides in some blood cells. H-Ala-Pro-pNA hydrochloride salt has been shown to be effective in preventing diabetic nephropathy in animal models by inhibiting DPPIV activity. H-Ala-Pro-pNA hydrochloride salt can be used to treat chronic hepatitis B and C infections. It binds to virus particles and prevents them from attaching themselves to host cells, thus preventing viral replication.Formula:C14H18N4O4Purity:Min. 95%Molecular weight:306.32 g/molAmylin (mouse, rat) trifluoroacetate
CAS:Amylin (mouse, rat) trifluoroacetate is a synthetic peptide, which is a derivative of the islet amyloid polypeptide (IAPP) found in rodent species. It is sourced from the pancreatic beta cells of mice and rats, where it is co-secreted with insulin. The mode of action involves regulation of glucose metabolism through its effects on gastric emptying, glucagon secretion, and satiety. These actions are crucial in managing postprandial blood glucose levels and provide insights into the pathophysiology of diabetes.Amylin (mouse, rat) trifluoroacetate is primarily used in research applications to study the mechanisms of amylin aggregation and its implications in type 2 diabetes. It also serves as a model for understanding the differences in amyloid fibril formation between human and rodent amylin, making it invaluable for the development of therapeutic strategies aimed at mitigating amyloid-related cellular toxicity. Researchers utilize this peptide to explore the potential compensatory roles of amylin analogs in diabetic models, advancing our understanding of diabetes progression and treatment options.Formula:C167H272N52O53S2•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,920.4 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C44H66N12O12Purity:Min. 95%Molecular weight:955.07 g/mol1-(Fmoc-aminomethyl)-b-D-galacturonic acid
CAS:Please enquire for more information about 1-(Fmoc-aminomethyl)-b-D-galacturonic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C22H23NO8Purity:Min. 95%Molecular weight:429.42 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molFor-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.Formula:C43H65N7O9Purity:Min. 95%Molecular weight:824.02 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS:Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.Formula:C63H90N14O16Purity:Min. 95%Molecular weight:1,299.47 g/molInsulin B (22-25)
CAS:Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/molN-Hippuryl-His-Leu trifluroacetate hydrate
CAS:Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).Formula:C21H27N5O5(C2F3O2)x(H2O)xPurity:Min. 95%Molecular weight:429.47 g/molBremelanotide
CAS:Bremelanotide is a synthetic cyclic peptide, classified as a melanocortin receptor agonist. It is derived from the analogs of the alpha-melanocyte-stimulating hormone (α-MSH), with its origins in melanocortin system research. This product acts primarily through the activation of melanocortin 4 receptor (MC4R) pathways in the central nervous system.Bremelanotide exerts its physiological effects by stimulating these receptors, leading to increased neural signals related to sexual arousal and desire. The melanocortin receptors, especially MC4R, play a significant role in modulating various neural networks involved in sexual function.This compound is utilized primarily for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women. By enhancing sexual desire and arousal, Bremelanotide provides a therapeutic option for individuals experiencing clinically significant distress related to low sexual desire. Its application in clinical settings highlights the potential of melanocortin pathways as therapeutic targets beyond their established roles in pigmentary and energy balance modulation.
Formula:C50H68N14O10Purity:Min. 95%Color and Shape:White PowderMolecular weight:1,025.16 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Orexin A (17-33) trifluoroacetate salt
CAS:Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesisFormula:C79H125N23O22Purity:Min. 95%Molecular weight:1,748.98 g/molDesmopressin
CAS:Controlled ProductDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069.22 g/molFibrinogen beta-Chain (24-42)
Catalogue peptide; min. 95% purityFormula:C86H135N25O27Molecular weight:1,951.19 g/molbFGF Inhibitory Peptide II
Catalogue peptide; min. 95% purity
Formula:C94H148N30O28SMolecular weight:2,178.48 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/molCys-GM-CSF (17-31)
Catalogue peptide; min. 95% purity
Formula:C76H133N28O25SMolecular weight:1,871.14 g/molZ-N-Me-Ser(tBu)-OH·DCHA
CAS:Please enquire for more information about Z-N-Me-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H23NO5·C12H23NPurity:Min. 95%Molecular weight:490.68 g/molH-D-Ile-Asp-OH
CAS:Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/molAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formula:C165H261N51O55S2Purity:Min. 95%Molecular weight:3,903.28 g/molZ-Thr(Bzl)-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C19H21NO5·C12H23NPurity:Min. 95%Molecular weight:524.69 g/molBpoc-Gly-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Bpoc-Gly-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C18H19NO4·C12H23NPurity:Min. 95%Molecular weight:494.67 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Cathelicidin LL 37
CAS:LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.Formula:C205H340N60O53Purity:Min. 95%Molecular weight:4,493.27 g/molFmoc-Leu-Cys(Psi(Dmp,H)pro)-OH
CAS:Please enquire for more information about Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C33H36N2O7SPurity:Min. 95%Molecular weight:604.71 g/molOrexin A trifluoroacetate
CAS:Please enquire for more information about Orexin A trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C152H243N47O44S4•(C2HF3O2)xPurity:Min. 95%Nps-Val-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molGlutaryl-Phe-bNA
CAS:Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C24H24N2O4Purity:Min. 99 Area-%Molecular weight:404.46 g/molPmc-S-methylisothiourea
CAS:Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/molIsovaleryl-Val-Val-Sta-OEt
CAS:Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.Formula:C25H47N3O6Purity:Min. 95%Molecular weight:485.66 g/molBoc-epsilon-azido-Nle-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Boc-epsilon-azido-Nle-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C11H20N4O4·C12H23NPurity:Min. 95%Molecular weight:453.62 g/molFmoc-Lys(Boc)-Wang resin (200-400 mesh)
CAS:Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purity:Min. 95%Molecular weight:604.65 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purity:Min. 95%Molecular weight:499.48 g/molNps-Lys(Boc)-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C17H25N3O6S·C12H23NPurity:Min. 95%Molecular weight:580.78 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purity:Min. 95%Color and Shape:SolidMolecular weight:355.39 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:402.65 g/molH-Ile-His-OH
CAS:H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.
Formula:C12H20N4O3Purity:Min. 95%Molecular weight:268.31 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled ProductPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/mol[D-Tyr6, beta-Ala11, beta-Phe13, Nle14]-Bombesin
Catalogue peptide; min. 95% purity
Formula:C81H115N23O18Molecular weight:1,698.98 g/mol[Des-Pro2] Bradykinin
Catalogue peptide; min. 95% purity
Formula:C45H66N14O10Molecular weight:963.12 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formula:C52H84N14O21Molecular weight:1,241.33 g/molα-Helical CRF (9-41)
Catalogue peptide; min. 95% purityFormula:C166H274N46O53S2Molecular weight:3,826.44 g/molR-G-D-S-P-A-S-S-K-P
Catalogue peptide; min. 95% purityFormula:C40H68N14O16Molecular weight:1,001.07 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Molecular weight:3,935.55 g/molAtrial Natriuretic Factor (4-28) (human)
Catalogue peptide; min. 95% purityFormula:C112H175N39O35S3Molecular weight:2,724.02 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Molecular weight:1,770.34 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SMolecular weight:1,522.81 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SMolecular weight:1,059.31 g/molα-Conotoxin MI
Catalogue peptide; min. 95% purityFormula:C58H92N22O17S4Molecular weight:1,497.74 g/molbeta-Endorphin (1-26), human
Catalogue peptide; min. 95% purityFormula:C130H208N32O38SMolecular weight:2,859.36 g/molRSK Substrate, S6 (231-239)
Catalogue peptide; min. 95% purityFormula:C45H88N22O11Molecular weight:1,113.34 g/mol[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)
Catalogue peptide; min. 95% purityFormula:C26H33N5O5Molecular weight:495.58 g/molL-Lysyl-L-lysine dihydrochloride
CAS:Lysyllysine dihydrochloride: enzyme-cleavable linker for delivering bioactive peptides.Formula:C12H28Cl2N4O3Purity:≥98%Color and Shape:SolidMolecular weight:347.28CDPKS, Syntide analog
Catalogue peptide; min. 95% purityFormula:C47H86N16O13Molecular weight:1,083.31 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Molecular weight:4,017.55 g/molBiotin-Somatostatin-14
Catalogue peptide; min. 95% purityFormula:C86H118N20O21S3Molecular weight:1,864.21 g/molDynorphin A (8-17), porcine
Catalogue peptide; min. 95% purityFormula:C59H96N18O15Molecular weight:1,297.53 g/mol[D-Ala2] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C28H37N5O7SMolecular weight:587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Molecular weight:1,319.58 g/mol[Tyr11]-Somatostatin
Catalogue peptide; min. 95% purity
Formula:C76H102N18O20S2Molecular weight:1,651.91 g/molα-Conotoxin GI
Catalogue peptide; min. 95% purityFormula:C55H76N20O18S4Molecular weight:1,433.63 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formula:C103H156N32O25Molecular weight:2,242.59 g/mol4A/4B, Peptide (1)
Catalogue peptide; min. 95% purityFormula:C67H100N16O25S2Molecular weight:1,593.76 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formula:C72H108N19O27Molecular weight:1,702.77 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SMolecular weight:1,347.66 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SMolecular weight:2,314.59 g/molGPC3 (298-306), mouse
Catalogue peptide; min. 95% purityFormula:C51H81N9O18Molecular weight:1,108.26 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
Catalogue peptide; min. 95% purityFormula:C43H59N11O8Molecular weight:858.02 g/mol
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![[Lys8]-Vasotocin (free acid)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00301.webp&w=3840&q=75)
![[D-His26]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00910.webp&w=3840&q=75)
![[Met5, Lys6,7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00874.webp&w=3840&q=75)
![[D-Tyr6, beta-Ala11, beta-Phe13, Nle14]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00196.webp&w=3840&q=75)
![[Des-Pro2] Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00674.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00833.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00839.webp&w=3840&q=75)
![[Tyr11]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00218.webp&w=3840&q=75)
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)