Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30323 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-WVQDSMDHLDK^-OH
<p>Peptide H-WVQDSMDHLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGMQIFV^K-OH
<p>Peptide H-GGMQIFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HA peptide
CAS:<p>Haptens are small-molecule drugs that bind to the toll-like receptor. Haptens can be used as a vaccine adjuvant and have been shown to be effective in the prevention of pandemic influenza. Haptens also inhibit viral replication by binding to surface glycoproteins, which prevents them from attaching to host cells. This process triggers the production of reactive oxygen species (ROS) and other inflammatory cytokines, which ultimately result in significant cytotoxicity. Haptens are capable of transferring immune responses from one animal to another, but this transfer is not always successful due to the basic protein structure of haptens.</p>Formula:C53H67N9O17Purity:Min. 95%Molecular weight:1,102.18 g/molH-TPPSSGEPPK^-OH
<p>Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C34, gp41 HIV Fragment
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C184H280N50O64S1Molecular weight:4,248.8 g/molH-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAVYADQAK^-OH
<p>Peptide H-AVAVYADQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H79N11O14S2Molecular weight:1,050.31 g/molH-VTQSNFAVGYK^-OH
<p>Peptide H-VTQSNFAVGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-L^QSLFDSP^DFSK^-OH
<p>Peptide H-L^QSLFDSP^DFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLATVYVDVLK^-OH
<p>Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
<p>Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RK9, p17 Gag (20 - 28)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H86N18O10Molecular weight:1,039.3 g/mol5Fam-VIFDANAPVAVR-OH
<p>Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-KNIVTPRTPPPSQGK-NH2
<p>Peptide LCBiot-KNIVTPRTPPPSQGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQSENFEYVAFK^-OH
<p>Peptide H-SQSENFEYVAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GITNIN-NH2
<p>Peptide Ac-GITNIN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYTVDLGR^-OH
<p>Peptide H-VYTVDLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IHWESASLLR^-OH
<p>Peptide H-IHWESASLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bid BH3-r9 TFA
<p>Catalogue peptide; min. 95% purity</p>Formula:C151H272N70O42S•(C2HF3O2)xMolecular weight:3,772.36 g/molH-TEYKLVVVGADGVGK^-OH
<p>Peptide H-TEYKLVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Val-Glu-Ile-Asp-AMC
CAS:<p>Ac-Val-Glu-Ile-Asp-AMC is a cell death inducer that is used to study the mechanisms of apoptosis. It has been shown to cause neuronal death in culture and also to inhibit the growth of cultured cells by inducing the activation of caspase-9, which causes protease activity. Ac-Val-Glu-Ile-Asp-AMC has been shown to induce heart function in vivo, as well as to stimulate mitochondrial membrane potential and mitochondrial cytochrome c release. This compound also induces autophagy in vitro and can affect fatty acid metabolism.</p>Formula:C32H43N5O11Purity:Min. 93 Area-%Color and Shape:PowderMolecular weight:673.71 g/molH-VWESATPLR^-OH
Peptide H-VWESATPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LASYQAAR^-OH
<p>Peptide H-LASYQAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Salivary peptide gSG6-P1
<p>Peptide Salivary peptide gSG6-P1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C119H180N34O36S2Color and Shape:PowderMolecular weight:2,727.07 g/molH-FLPSDFFPSI^-OH
<p>Peptide H-FLPSDFFPSI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hippuryl-Lys-Val-OH
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C20H30N4O5Molecular weight:406.5 g/molH-TSYQVY^SK^-OH
Peptide H-TSYQVY^SK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIYAASNLETGVPSR^-OH
<p>Peptide H-LLIYAASNLETGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-32/aa125 - 139
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,731.9 g/molH-LDVDQALNR^-OH
<p>Peptide H-LDVDQALNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAGVILAPLQR^-OH
<p>Peptide H-NAGVILAPLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETLLQDFR^-OH
Peptide H-ETLLQDFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CA-074
CAS:<p>CA-074 is a research tool that can be used to study protein interactions. CA-074 is a small, synthetic peptide and a potent inhibitor of the ion channel TRPC1. It has been shown to inhibit the calcium currents in HEK293 cells expressing TRPC1 channels. CA-074 inhibits the kinase activity of PLCγ2, which leads to reduced phosphoinositide levels and a decrease in cell proliferation. CA-074 also inhibits PKCδ and PKCε, which are members of the protein kinase C family.<br>The inhibition of these enzymes by CA-074 causes an increase in the intracellular concentration of diacylglycerol (DAG) and inositol triphosphate (IP3). These two molecules are involved in G protein signaling pathways that regulate cell proliferation, differentiation, and survival.</p>Formula:C18H29N3O6Purity:Min. 95%Molecular weight:383.44 g/molHXB2 gag NO-33
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,719 g/molAc-KFKFKFKF-NH2
<p>Peptide Ac-KFKFKFKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Thz-Tle-Leu-Gln-MCA
CAS:<p>A prototype fluorogenic substrate targeting the SARS-CoV and SARS-CoV-2 Main Protease (Mpro). The main protease (Mpro), also called endopeptidase C30 or 3C-like proteinase (3CLpro), controls viral replication activities and is a prime therapeutical target. Both substrates and inhibitors of SARS-CoV-2 Mpro are currently of interest to researchers of the coronavirus. This product can be used as a Prototype Fluorescence Substrate for SARS-CoV Mpro/SARS-CoV-2 Mpro Proteases.</p>Formula:C13H17NO3Purity:Min. 95%Molecular weight:235.28 g/molH-APAATVVNVDEVR^-OH
<p>Peptide H-APAATVVNVDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-SSTGSIDMVD-NH2
<p>Peptide LCBiot-SSTGSIDMVD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PAMP (Human)
CAS:<p>PAMP (human) is a peptide that binds to the G-protein coupled receptor, M3. It activates the ion channel and induces an influx of calcium ions into cells. This can lead to cell proliferation and differentiation, as well as increased blood flow in the brain. PAMP has been shown to inhibit ligand-induced activation of M3 receptors by competing with the natural ligands for binding sites on these receptors. It has also been shown to have high purity (>95%), and is currently under research for its use in various medical applications such as cancer therapy, pain management, and treatment of respiratory diseases.</p>Formula:C112H178N36O27Purity:Min. 95%Molecular weight:2,460.8 g/molH-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Activity-Dependent Neurotrophic Factor, ADNF
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C41H74N12O12Molecular weight:927.12 g/molH-YNWNSFGLR^Y-NH2
<p>Peptide H-YNWNSFGLR^Y-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFPIIDDR^-OH
Peptide H-LPFPIIDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide K
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C175H284N52O52SMolecular weight:3,980.4 g/molH-YGIDWASGR^-OH
<p>Peptide H-YGIDWASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pal-RWKFGGFKWR-OH
<p>Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Eptifibatide
CAS:<p>Eptifibatide is a drug that is used in the treatment of congestive heart failure, acute coronary syndrome and peripheral artery disease. It is a glycoprotein IIb/IIIa inhibitor that binds to integrin receptors on platelets and prevents them from binding to fibrinogen. This prevents blood clotting and reduces the risk of stroke or heart attack. Eptifibatide has been shown to be effective for the treatment of bowel disease, infectious diseases, and experimental models of myocardial infarcts. The drug has significant cytotoxicity, which may be due to its ability to inhibit cell proliferation by blocking protein synthesis at the ribosome level.<br>Eptifibatide has been shown to have a disulfide bond between two cysteine residues located in its amino-terminal region. This bond stabilizes the molecule in solution and ensures that it remains active until it reaches its target site.</p>Formula:C35H49N11O9S2Purity:Min. 95%Molecular weight:831.98 g/molH-KIPNPDFFEDLEPFR^-OH
<p>Peptide H-KIPNPDFFEDLEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYI^HPFHL-OH
<p>Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPNALTDDR^-OH
<p>Peptide H-VPNALTDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRRFSTAPFAFININNVINF-NH2
Peptide H-LRRFSTAPFAFININNVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fibrinogen γ-Chain (117-133)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C84H147N25O27Molecular weight:1,939.26 g/molH-SP^SYAYHQF-OH
<p>Peptide H-SP^SYAYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIWNVINWENVTER^-OH
<p>Peptide H-AIWNVINWENVTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDPQGDAAQK^-OH
<p>Peptide H-EDPQGDAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
Peptide H-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HYGGLTGLNK^-OH
Peptide H-HYGGLTGLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SANILLDEAFTAK^-OH
<p>Peptide H-SANILLDEAFTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HPV 33 E6 64-72 (HLA-A*03:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Aoa-HHHHH-OH
Peptide Aoa-HHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISASAEELR^-OH
<p>Peptide H-ISASAEELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDQSIQK^-OH
<p>Peptide H-DDQSIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVFPLAP^SSK^-OH
<p>Peptide H-GPSVFPLAP^SSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 45 (EPDVYYTSAFVFPTK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,764 g/molH-TITNDR^-OH
<p>Peptide H-TITNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phytochelatin 2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-HIFDHVIGPEGVLAGK^-OH
<p>Peptide H-HIFDHVIGPEGVLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGAHAGEYGAEALER^^-OH
<p>Peptide H-VGAHAGEYGAEALER^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-OH
Peptide LCBiot-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HSV-gB2 (498-505)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C41H67N11O13Molecular weight:922.06 g/molSIVmac239 - 26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,709 g/molH-IATEAIENFR^-OH
Peptide H-IATEAIENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPAPRRGEPHVTRRTPDYFL-OMe
Peptide H-DPAPRRGEPHVTRRTPDYFL-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSSLPSVTLK^-OH
<p>Peptide H-VSSLPSVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH
<p>Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Leu-Thr-Ile-Ile-Pro-Gln-Asp-Pro-Ile-Leu-Phe-Ser-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C82H136N20O23Molecular weight:1,770.08 g/molH-DL^AFPGSGEQV^EK-OH
Peptide H-DL^AFPGSGEQV^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGGGGC-NH2
Peptide H-GGGGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-[[2-[[2-[[2-[[2-[[5-Amino-2-[[5-amino-2-[[1-[6-amino-2-[[1-[2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]am ino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]-3-phenylpropanoyl]amino]-3-phenylpr
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H98N18O13SMolecular weight:1,348.65 g/molCMVpp65 - 19 (NQLQVQHTYFTGSEV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,750.9 g/molH-LLLASPR^-OH
Peptide H-LLLASPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.WT1 126-134 mutant (HLA-A*02:01) 126Y
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C55H74N10O13SMolecular weight:1,115.3 g/molH-IL^GG-NH2
<p>Peptide H-IL^GG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 176
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,658.9 g/molH-QDGNEEMGGITQTPY-NTPEGBiot
<p>Peptide H-QDGNEEMGGITQTPY-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GCSFLPDPYQK^-OH
<p>Peptide H-GCSFLPDPYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELYETASELPR^-OH
Peptide H-ELYETASELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGDIVEFVCK^-OH
<p>Peptide H-TGDIVEFVCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPLTTPVGGGIR^-OH
<p>Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVDEALR^-OH
<p>Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPKPQQFFGLM-NH2
<p>Peptide H-RPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CTETVKAEKMETD-OH
Peptide Ac-CTETVKAEKMETD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.cAMP Dependent PK Inhibitor (5-24), amide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C94H149N33O30Molecular weight:2,221.4 g/molH-VNVDEVGGEALGR^^-OH
<p>Peptide H-VNVDEVGGEALGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ß-Endorphin (Equine)
CAS:<p>ß-Endorphin, also known as Equine ß-Endorphin, is a polypeptide hormone that is a member of the endorphin family. It is a peptide consisting of nine amino acids. ß-Endorphin has been found in the pituitary gland and in other tissues in concentrations much higher than those of other endorphins. Beta-endorphin is thought to be involved in pain relief and stress relief.</p>Formula:C154H248N42O44Purity:Min. 95%Molecular weight:3,424.01 g/molBig Endothelin-3 (Human, 1-41 Amide) Acetate
CAS:<p>Big Endothelin-3 (Human, 1-41 Amide) is a precursor molecule of the Endothelin-3 (ET-3) peptide, that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11.</p>Formula:C223H322N56O63S4Purity:Min. 95%Molecular weight:4,923.65 g/molH-VTEPISAESGEQVER^-OH
Peptide H-VTEPISAESGEQVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^RRQFKVVT-OH
<p>Peptide H-YGGFL^RRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KRHR-NH2
<p>Peptide Ac-KRHR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AAAAAAAAAC-NH2
<p>Peptide Ac-AAAAAAAAAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Rhod-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Rhod-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LRLRGG-OH
<p>Peptide Ac-LRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,824.4 g/molH-NLVVIPK^-OH
Peptide H-NLVVIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQGLPQEVLNENLLR^-OH
<p>Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ghrelin (Human)
CAS:Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology. This product is available in the salt form: Trifluoroacetate.Formula:C149H249N47O42Purity:Min. 95%Molecular weight:3,370.87 g/molH-VEEQEPELTSTPNFVVEVIK^-OH
<p>Peptide H-VEEQEPELTSTPNFVVEVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAVNALWGK^-OH
Peptide H-TAVNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILFVGSGVSGGEEGAR^-OH
<p>Peptide H-GILFVGSGVSGGEEGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HNLGHGHK^-OH
<p>Peptide H-HNLGHGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASHEEVEGL^VEK^-OH
<p>Peptide H-ASHEEVEGL^VEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SPQLATLADEVSASLAKQGL-OH
<p>Peptide Ac-SPQLATLADEVSASLAKQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLQTDSIDSFETQR^-OH
Peptide H-TLQTDSIDSFETQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLFLNHSENATAK^-OH
Peptide H-NLFLNHSENATAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNLEWK^-OH
<p>Peptide H-GNLEWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGVLVQPG-NTBiot
<p>Peptide H-GGVLVQPG-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNQIDHIDEK^-OH
Peptide H-NNQIDHIDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gastrin Releasing Peptide, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C130H204N38O31S2Molecular weight:2,859.4 g/molAc-KPQTPRRRPSSPAPGPSRQSSSVGSC-NH2
Peptide Ac-KPQTPRRRPSSPAPGPSRQSSSVGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLLDTASALYR^-OH
Peptide H-DLLDTASALYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-25
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,761.9 g/molCMVpp65 - 46 (YYTSAFVFPTKDVAL)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,722 g/molH-NLNSLSEL^EVK-OH
<p>Peptide H-NLNSLSEL^EVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYAASSLQSGVPSR^-OH
Peptide H-LLIYAASSLQSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DI^TP^TLTL^YVGK^-OH
<p>Peptide H-DI^TP^TLTL^YVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Endothelin-1 (1-31) (Human)
CAS:<p>Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure. Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial.</p>Formula:C162H236N38O47S5Purity:Min. 95%Molecular weight:3,628.2 g/molMyelin Basic Protein (87-99) (human, bovine, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C74H114N20O17Molecular weight:1,555.84 g/molAc-QVPLRPMTYK-OH
<p>Peptide Ac-QVPLRPMTYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAPDNL^GYM-OH
<p>Peptide H-TAPDNL^GYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NRV-NH2
<p>Peptide Ac-NRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 30 (PLKMLNIPSINVHHY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,776.1 g/molH-DFTAAFPR^-OH
<p>Peptide H-DFTAAFPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Le
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C90H167N15O16Molecular weight:1,715.38 g/molBiot-KPLLIIAEDVEGEY-OH
<p>Peptide Biot-KPLLIIAEDVEGEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>E-64-d
CAS:<p>E-64-d is a research tool that is used in cell biology, pharmacology, and biochemistry to study protein interactions. E-64-d is an activator, ligand, or receptor for ion channels and has been shown to inhibit the activity of high purity K+ channels. This peptide binds to the extracellular loop of voltage-gated potassium channels (Kv1.2) and inhibits the opening of these channels by blocking their access to ATP. E-64-d also binds to an antibody as a competitive inhibitor of the antigen binding site on the antibody.</p>Formula:C17H30N2O5Purity:Min. 95%Molecular weight:342.43 g/mol(Z-Asp-Glu-Val-Asp)2-Rh110
CAS:<p>This is a synthetic peptide that can be used as an enzyme substrate for the study of caspase activity. It is a peptide that has been designed to mimic the sequence of amino acids in the active site of caspase-7 and caspase-3. This peptide is useful for biochemical research, especially in the study of apoptosis.</p>Formula:C56H66N10O23Purity:Min. 95%Molecular weight:1,247.19 g/molFluor-HNSSLSPLATPA-OH
Peptide Fluor-HNSSLSPLATPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-γ-Abu-OH
CAS:<p>Fmoc-γ-Abu-OH is a fatty acid that belongs to the group of neurotrophic factors. It has been shown to have neuroprotective properties in vitro and in vivo, and its mechanism may be related to its inhibition of apoptotic cell death. Fmoc-γ-Abu-OH also has pharmacokinetic properties, which are dependent on the route of administration. This compound is absorbed through the gastrointestinal tract and distributed throughout the body with a half-life of approximately 12 hours. Fmoc-γ-Abu-OH binds to β-catenin and inhibits its degradation by proteasomes, thereby increasing its levels in cells.</p>Formula:C19H19NO4Purity:Min. 95%Molecular weight:325.37 g/molSDADLinker-GGEPEA-OH
Peptide SDADLinker-GGEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KTEEISEVNLDAEF-NH2
<p>Peptide Ac-KTEEISEVNLDAEF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-DLDLEMLAPYIPMDDDFQL-OH
<p>Peptide LCBiot-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETTVFENLPEK^-OH
<p>Peptide H-ETTVFENLPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[pTyr5] EGFR (988-993)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C31H45N6O17PMolecular weight:804.69 g/molAngiotensinogen (1-14), porcine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C85H123N21O20Molecular weight:1,759.04 g/molH-VELAPLPSWQPVGK^-OH
<p>Peptide H-VELAPLPSWQPVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2
<p>Peptide LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEHWGLDEPLLK^-OH
<p>Peptide H-VEHWGLDEPLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IGRP 265-273 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolBoc-γ-Abu-OH
CAS:<p>Boc-γ-Abu-OH is a model drug used in peptide synthesis. It is a building block that can be used to form the amino acid γ-Abu. This amino acid has an unusual β-amino group, which is coupled with the Boc group using photorelease chemistry. The resulting compound can be used as a building block for dendrimer or convergent syntheses.<br>Boc-γ-Abu-OH reacts with dimethoxybenzene and dendron to form γ-Abu. The resulting product can be reacted with other molecules, such as diamines and benzyl halides, to produce analogues of γ-Abu. This process allows for the synthesis of new compounds that have not been previously reported in the literature.</p>Formula:C9H17NO4Purity:Min. 95%Molecular weight:203.24 g/molH-IYVDDGLISLQVK^-OH
Peptide H-IYVDDGLISLQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GCRDGPQGIAGQDRCG-OH
Peptide Ac-GCRDGPQGIAGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VITAFNDGLNHLDSLK^-OH
Peptide H-VITAFNDGLNHLDSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TKRWGFRSGVPPKVVC-NH2
<p>Peptide Ac-TKRWGFRSGVPPKVVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GNPARARERLKNIERIC-NH2
<p>Peptide Ac-GNPARARERLKNIERIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-ADEYLIPQQ-OH
<p>Peptide LCBiot-ADEYLIPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYHPRDHTATWGGG-NH2
Peptide H-RDYHPRDHTATWGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELNEALELK^-OH
<p>Peptide H-ELNEALELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C40H59N11O15Molecular weight:933.97 g/molAc-CAT-NH2
<p>Peptide Ac-CAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEVSQLLK^-OH
<p>Peptide H-IEVSQLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLSAPGNLLTK^-OH
Peptide H-SLSAPGNLLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGGFL^-OH
Peptide H-YGGFL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGSLGNIHHKPGGGQVEVK^-OH
Peptide H-CGSLGNIHHKPGGGQVEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPDAVATWLKPDPSQK^-OH
<p>Peptide H-YPDAVATWLKPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-AASHVDNEYSQPPRNSRLSAYPALE-OH
<p>Peptide Biot-AASHVDNEYSQPPRNSRLSAYPALE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-0
CAS:<p>A hydroxamate-based inhibitor of collagenase, gelatinase, and TACE. TACE stands for Tumor Necrosis Factor-α Converting Enzyme. It is also known as ADAM17 (A Disintegrin and Metalloproteinase 17)</p>Formula:C24H32N4O5Purity:Min. 95%Molecular weight:456.54 g/molH-GLVPFLVSV^-OH
<p>Peptide H-GLVPFLVSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENEGFTVTAEGK^-OH
<p>Peptide H-ENEGFTVTAEGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACTH (1-24), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C136H210N40O31SMolecular weight:2,933.5 g/molH-NSILTETLHR^-OH
Peptide H-NSILTETLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQPLSPEK^-OH
<p>Peptide H-GQPLSPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CFLSPEELQSLVPLSD-NH2
<p>Peptide Ac-CFLSPEELQSLVPLSD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGIIWVATEGALNTPK^-OH
<p>Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSAPATGGVKKPHR^-OH
<p>Peptide H-KSAPATGGVKKPHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HP^DASVNFSEFSK-OH
Peptide H-HP^DASVNFSEFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hemopexin [069-079]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-CTHGTSMNRVIEEDGTSA-OH PAB-406-1589A
Peptide Ac-CTHGTSMNRVIEEDGTSA-OH PAB-406-1589A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-HAIYPRH-OH
<p>Peptide LCBiot-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 62
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,638.9 g/molH-SEPEA-OH
<p>Peptide H-SEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Color and Shape:PowderAc-VPAPRYTVELAC-NH2
<p>Peptide Ac-VPAPRYTVELAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPQTPL^HTSR-OH
<p>Peptide H-CVPQTPL^HTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AEEE-NH2
<p>Peptide Ac-AEEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQEALDFYGEVR^-OH
Peptide H-AQEALDFYGEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTAVTRPVETHELIR^-OH
<p>Peptide H-TTAVTRPVETHELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYQDLLNVK^-OH
<p>Peptide H-EYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Glu1] Fibrinopeptide B, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C66H95N19O26Molecular weight:1,570.6 g/molBoc-D-Asp(OcHex)-OH
CAS:<p>Boc-D-Asp(OcHex)-OH is a peptide that belongs to the group of activators. It binds to the receptor and induces a conformational change in the receptor protein, which leads to activation of an ion channel. Boc-D-Asp(OcHex)-OH is also known as orexin A, which is a peptide that regulates appetite and sleep. This compound has been shown to stimulate the release of histamine from mast cells and inhibit tumor necrosis factor production. It has been used as a research tool for studying protein interactions and ligand binding. Boc-D-Asp(OcHex)-OH has been shown to be an inhibitor of calcium channels, potassium channels, and sodium channels in vitro at low concentrations (10 μM).</p>Formula:C15H25NO6Purity:Min. 95%Molecular weight:315.37 g/molH-E-boro-Pro-OH
<p>Peptide H-E-boro-Pro-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGPGQSKVIG-NH2
<p>Peptide H-LGPGQSKVIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β-Lipotropin (61-69)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H66N10O15SMolecular weight:1,019.15 g/molH-DLAFPGSGEQVEK^-OH
Peptide H-DLAFPGSGEQVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CNPHPYNEGYVY-NH2
<p>Peptide H-CNPHPYNEGYVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLAQLNPESSLFIIASK^-OH
Peptide H-TLAQLNPESSLFIIASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[pTyr5] EGFR (988-993)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50058.webp&w=3840&q=75)
![Hemopexin [069-079]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50800.webp&w=3840&q=75)
![[Glu1] Fibrinopeptide B, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50447.webp&w=3840&q=75)
