Biochemicals and Reagents

<p>Peptide H-IKGEEKVAPYHVQYTCLHENLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CMV antibody was raised in mouse using glycoprotein B of CMV as the immunogen.</p>

<p>Exatecan Mesylate, scientifically recognised as DX-8951f, is a hexacyclic chemical compound analogous to camptothecin, with essential antitumoral properties. Exatecan mesylate is used as an inhibitor of DNA topoisomerase I, that plays a key role in DNA replication, transcription, and recombination. Therefore, the use of exatecan mesylate is of great importance in prompting cell division and triggering cell death (Giles, 2000).</p>

<p>Peptide H-GFYPSDIAVEWESNGQPENNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IL1b antibody was raised in mouse using E. Coli-derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>

<p>Feline Serum Amyloid A Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Serum Amyloid A Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-THPHFVIPYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Antagonist of OX1 orexin receptor</p>

<p>Biotin antibody was raised in goat using biotin conjugated to KLH as the immunogen.</p>

<p>Peptide H-EL^SEALGQIFDSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Rat IgG, Enriched is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Rat IgG, Enriched including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-CLAVEEVSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CEKEEDERVQGGDREPLLQEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. This active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Syntide-2 is a substrate peptide which was specifically designed to be homologous to site 2 in glycogen synthase. Syntide-2 is therefore phosphorylated by Ca2+ calmodulin-dependent protein kinase II as well as other calcium dependant kinases and protein kinase C. Synthase-2 can also be phosphorylated by CAMP-dependent protein kinase and to a lesser extent- phosphorylase kinase, but not by myosin light chain kinase.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>CEA protein is a necrosis factor-related apoptosis-inducing protein that plays a crucial role in cell death. It can be targeted using monoclonal antibodies that specifically bind to its tyrosine residues. CEA protein is widely studied in the field of Life Sciences and has been found to have various functions, including promoting endothelial growth and acting as a growth factor. Native Proteins &amp; Antigens related to CEA protein are available for research purposes, such as studying its interactions with other molecules like erythropoietin or investigating its glycation and glycosylation patterns. Nuclear extracts containing CEA protein can be used in assays and experiments to further understand its role in cellular processes. Additionally, specific antibodies against CEA protein are available for detecting and quantifying its presence in biological samples.</p>

<p>Bis-Tris is a Bis(2-hydroxyethyl) amine buffer that forms metal chelates and can be used with proteins and nucleic acids. This buffering agent has an optimal pH range of 5.8-7.2 and a pKa of 6.46.</p>

<p>Influenza A Virus Haemagglutinin H5 Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A Virus Haemagglutinin H5 Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-DLVFSTWDHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cytokeratin 19 antibody was raised in mouse using human reduction mammoplasty organoids as the immunogen.</p>

<p>Peptide Ac-LWWPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified native Human alpha 1 Acid Glycoprotein protein</p>

<p>CEA, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CEA, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about Human Saliva including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta galactosidase antibody was raised in rabbit using full length native beta galactosidase isolated from E.coli as the immunogen.</p>

<p>Peptide H-QQF^FGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Partial agonist of cortical and hippocampal muscarinic (M1) receptors</p>

<p>H-EYDEPYVLLQNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EYDEPYVLLQNK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EYDEPYVLLQNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EYDEPYVLLQNK-OH at the technical inquiry form on this page</p>

<p>Ferritin Goat Polyclonal Antibody, IgG Fraction is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Ferritin Goat Polyclonal Antibody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Toxoplasma gondii protein is a versatile and potent protein that belongs to the family of kinase inhibitors. It is commonly used in research and diagnostic applications due to its ability to elicit a specific immune response. This protein can be targeted by monoclonal antibodies, which are highly specific and can be used for various applications such as immunohistochemistry and flow cytometry. One of the key characteristics of Toxoplasma gondii protein is its nephrotoxicity, which makes it an ideal candidate for studying kidney-related diseases and conditions. Additionally, this protein has shown promising effects on mesenchymal stem cells, promoting their proliferation and differentiation. Autoantibodies against Toxoplasma gondii protein have been identified in certain autoimmune diseases, suggesting its potential role in the pathogenesis of these conditions. Furthermore, this protein has been found to induce apoptosis through the activation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) pathways</p>

<p>Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about C.I.Solvent Blue 24 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CKMM antibody was raised in goat using Human CKMM as the immunogen.</p>

<p>Peptide H-YLIPNATQPESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WRWYCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ziprasidone is an antipsychotic drug that is used to manage schizophrenia and bipolar mania. Ziprasidone binds to dopamine and serotonin receptors in the brain, which causes it to have a synergic effect with other drugs such as benzodiazepines.</p>

<p>D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.</p>

<p>Purified native Human beta 2 Microglobulin protein</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Valproic Acid antibody was raised in mouse using valproic acid conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Rigorous testing using the patch-clamp technique on human erythrocytes has demonstrated its high frequency of human activity. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Peptide H-TTPPVLDSDGSFFLVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>4-[[3-(Trifluoromethyl)phenyl]methyl]-2H-1,4-benzothiazin-3(4H)-one is a novel compound that inhibits the activation of microglia and reduces the Ca2+ concentration in activated microglia. It also has a safety profile and does not affect blood pressure or cause autoimmune diseases. Functional assays show that 4-[[3-(Trifluoromethyl)phenyl]methyl]-2H-1,4-benzothiazin-3(4H)-one inhibits the production of inflammatory cytokines such as IL-6 and TNFα.</p>

<p>Adenosine A2A receptor antagonist</p>

<p>Chikungunya virus antibody is a monoclonal antibody that is produced by a hybridoma cell line. It specifically targets non-phosphorylated epitopes on the Chikungunya virus and can be used for diagnostic purposes. This monoclonal antibody has high specificity and sensitivity, making it an ideal tool for detecting the presence of Chikungunya virus in patient samples. The antibody is conjugated to colloidal gold or other markers, allowing for easy visualization of the viral antigen. It can also be used in various immunoassay formats such as ELISA or lateral flow assays. The Chikungunya virus antibody is widely used in life sciences research and has applications in studying the pathogenesis of the virus, developing vaccines, and screening potential antiviral drugs.</p>

<p>H-RVTHPHLPRALMRC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RVTHPHLPRALMRC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RVTHPHLPRALMRC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RVTHPHLPRALMRC-OH at the technical inquiry form on this page</p>

<p>Peptide Kemptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Docetaxel is a cytotoxic semi-synthetic taxane and is an anthracycline antibiotic. The compound is an anti-microtubule agent and has significant inhibitory activity in solid tumors either alone or in combination with other chemotherapeutic agents.<br>Docetaxel trihydrate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready to use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Biot-GPETLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Luciferase antibody (FITC) was raised in goat using highly purified firefly luciferase as the immunogen.</p>

<p>H-GVVAEFDSPANLIAAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GVVAEFDSPANLIAAR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GVVAEFDSPANLIAAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GVVAEFDSPANLIAAR-OH at the technical inquiry form on this page</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.</p>

<p>Peptide H-IYLPHSL^^PQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TLQALEFHTVPFQLLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT</p>

<p>H. Pylori Flagellin Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about H. Pylori Flagellin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-PVPGVLLKEFTVSGN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PVPGVLLKEFTVSGN-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PVPGVLLKEFTVSGN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PVPGVLLKEFTVSGN-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Haptoglobin Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Haptoglobin Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-LHLILDYINGGELFTHLSQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LHLILDYINGGELFTHLSQR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LHLILDYINGGELFTHLSQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LHLILDYINGGELFTHLSQR-OH at the technical inquiry form on this page</p>

<p>Alkaline Phosphatase (ALP, Orthophosphoric-Monoester Phosphohydrolase, systematic name phosphate-monoester phosphohydrolase (alkaline optimum), EC 3.1.3.1, CAS Number [9001-78-9]) is an enzyme that catalyzes the following reaction:  a phosphate monoester + H2O → an alcohol + phosphate  One unit catalyzes of the Alkaline Phosphatase will hydrolyze 1.0 μmol of p-nitrophenyl phosphate per minute at pH 10.4 and 37°C in glycine buffer. Human placental alkaline phosphatase comes in lyophilized form, lyophilized from tris chloride, with magnesium chloride and zinc chloride, pH 7.4. Activity is ≥10U/mg, specific activity ≥25 U/mg protein. It is soluble in Tris buffered saline containing 10 mg/mL BSA, 1 mM magnesium chloride, and 0.2 mM zinc chloride, pH 8.0. at 10 mg/mL.</p>

<p>CD31 antibody was raised in mouse using lewis rat microglia as the immunogen.</p>

<p>Peptide H-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-DEPHHTQEPSTSEDNC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DEPHHTQEPSTSEDNC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DEPHHTQEPSTSEDNC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DEPHHTQEPSTSEDNC-NH2 at the technical inquiry form on this page</p>

<p>Morphine-BSA is a product commonly used in the Life Sciences field. It is a conjugate of morphine and bovine serum albumin (BSA). This product has various applications, including research on androgen receptors, annexin neutralizing antibodies, teriparatide growth factor, osteopontin binding proteins, hybridization with anti-beta amyloid monoclonal antibodies, and more.</p>

<p>Peptide H-VLGSGAFGTVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>AHNAK antibody was raised in mouse using recombinant Human Ahnak Nucleoprotein (Desmoyokin) (Ahnak)</p>

<p>Autoimmune Hepatitis Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Autoimmune Hepatitis Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Keratin K19 antibody was raised in mouse using Keratin K19 of Mr 40 000 from cultured human MCF-7 cells as the immunogen.</p>

<p>Peptide H-IESVLSSSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Canine Distemper virus protein is a vital component in the field of Life Sciences. This protein is widely used in research and diagnostic applications. It is known for its cytotoxic and neutralizing properties, making it an essential tool for studying the Canine Distemper virus. Monoclonal antibodies specific to this protein have been developed, allowing for precise targeting and detection. Additionally, the conformational epitope of this protein has been extensively studied, enabling researchers to gain insights into its structure and function. Canine Distemper virus protein can be used in various experimental setups, including studies on cyclase-activating peptide signaling pathways or the interaction with collagen and low-density lipoprotein receptors. When using this protein, it is recommended to handle it with care and follow proper safety protocols.</p>

<p>Somatostatin antibody was raised in rat using somatostatin conjugated to thyroglobulin as the immunogen.</p>

<p>Peptide LCBiot-PKYVKQNTLKLAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CKTQNSISRTAK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CKTQNSISRTAK-NH2 is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CKTQNSISRTAK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CKTQNSISRTAK-NH2 at the technical inquiry form on this page</p>

<p>Chymotrypsin antibody was raised in mouse using purified human pancreatic chymotrypsin as the immunogen.</p>

<p>BCL11A antibody was raised in Rabbit using Human BCL11A as the immunogen</p>

<p>Peptide Ac-KAARKSAPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Amphetamine antibody is a medicament that possesses inhibitory properties. It is a monoclonal antibody that specifically targets and binds to amphetamines, neutralizing their effects. This antibody has been shown to inhibit the activation of chemokine receptors by amphetamines, preventing their interaction with nuclear extracts and subsequent cellular responses. Additionally, the Amphetamine antibody has been found to have neutralizing activity against reactive amphetamine metabolites. This antibody holds great potential in the field of Life Sciences and can be used for various applications such as studying neurotrophic factors, natriuretic peptides, and transforming growth factor-beta 1 (TGF-β1).</p>

<p>Peptide H-G^FYPSDIAVEWESNGQPESNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about HIV-1-p24 Mouse Monoclonal Antibody, Biotinylated Conjugate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-VVAGVANALAHK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Aoa-YDVVLSFSSDSELVEAFGGNQNCLDEELKAH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-VTSAPDTRPAPGSTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSPGAFTPLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse polyclonal RDX antibody (FITC)</p>

<p>Antirheumatic; immunosuppressant; neuroprotective; neuroregenerative</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>ProBNP protein is a versatile product used in the field of Life Sciences. It is a protein that can be targeted with both polyclonal and monoclonal antibodies for various research purposes. The protein is commonly used in studies related to cardiomyocytes, as it plays a crucial role in cardiovascular health. ProBNP protein is also involved in the regulation of annexin, an inhibitory factor that affects cellular processes.</p>

<p>Peptide H-GTYHTNEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-QCQSLHGSEADTLRKVLVEV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QCQSLHGSEADTLRKVLVEV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QCQSLHGSEADTLRKVLVEV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QCQSLHGSEADTLRKVLVEV-OH at the technical inquiry form on this page</p>

<p>Peptide Biot-GRADSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YSPWTNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CLPYQDFKRDLSDYRERAR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLPYQDFKRDLSDYRERAR-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLPYQDFKRDLSDYRERAR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLPYQDFKRDLSDYRERAR-NH2 at the technical inquiry form on this page</p>

<p>PD 407824 is a small molecule that acts as a chaperone and functions in the cell cycle. PD 407824 has been shown to inhibit the growth of tumor cells in vitro by interfering with their ability to proliferate. This agent also inhibits the expression of epidermal growth factor (EGF) and, therefore, slows down tumor cell proliferation. PD 407824 inhibits cancer cell viability and increases apoptosis in vitro. It also induces the expression of colony-stimulating factors (CSFs), which may contribute to its anti-tumor effects. The mechanism by which PD 407824 works is not yet known, but it is thought to be due to inhibition of signaling pathways downstream of growth factor receptors.</p>

<p>Peptide H-GKWERPFEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>6-OAU is a chemical compound categorized as a cytokinin-like molecule, which is derived from natural plant sources. It functions by modulating gene expression and hormone pathways involved in various plant growth and developmental processes. The mode of action of 6-OAU largely revolves around mimicking the activity of cytokinins, essential plant hormones that regulate cell division, shoot and root growth, as well as delay senescence.</p>

<p>PF 846 is a research tool that was developed for use in cell biology, pharmacology, and ion channel ligand binding assays. It is an inhibitor of the Kv1.3 voltage-gated potassium channel, which is expressed in cardiac cells and neurons. PF 846 has been shown to inhibit L-type calcium channels and alpha-2A adrenergic receptors as well. PF 846 binds to the peptide receptor site of these channels, blocking the passage of ions or neurotransmitters. The high purity and high specificity of this compound make it useful for research applications in protein interactions and antibody generation.</p>

<p>Peptide H-YLEPGPVTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YSLEPVAVELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified Pig IgG FITC conjugate</p>

<p>Portion of Influenza A</p>

<p>H-SPSLIFTNR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SPSLIFTNR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SPSLIFTNR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SPSLIFTNR-OH at the technical inquiry form on this page</p>

<p>Purified Pig IgG (Fab'2)</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>CBP/p300 histone acetyltransferase activator</p>

<p>Peptide Fmoc-Ile-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILLAELEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GAGAGAGY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ASGYTFTSYEINWVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ASGYTFTSYEINWVR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ASGYTFTSYEINWVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ASGYTFTSYEINWVR-OH at the technical inquiry form on this page</p>

<p>Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB is a research tool used in the synthesis of peptides. It is an inhibitor that blocks the activity of the protein tyrosine phosphatase, which plays a role in the regulation of cell proliferation and differentiation. This resin can be used to produce peptides with cysteine residues that are important for binding to receptors or ion channels. Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB can also be used as a ligand to activate receptors or ion channels. The resin has a purity of 99% and contains less than 0.1% water, so it is suitable for use in research on proteins and cells.</p>

<p>Peptide H-INTVNSNTLPVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PWRPSHPVWMPT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LNVENPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>SARS-CoV-2 ORF3a (26-40)</p>

<p>SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Haemoglobin A1C (HbA1c) Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Haemoglobin A1C (HbA1c) Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.</p>

<p>Peptide Ac-CLFYPKQEESQTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Myr-RLYRKRIWRSAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5TAMRA-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AGGANSNVFSMFEQTQIQEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Residues 17-29 of the LL-37 peptide, also known as FK-13. FK-13 has near-similar anti-microbial and anti-cancer properties to LL-37. This core fragment also contains part of the LL-37 actin binding domain and can associate weakly with actin, actin binding protects this fragment from protease degradation.LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into several different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system- overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>C1 Esterase Inhibitor antibody was raised in goat using C1 esterase inhibitor purified from human plasma as the immunogen.</p>

<p>Acitretin is a synthetic retinoid that can be used to treat skin conditions such as acne, psoriasis, and eosinophilic fasciitis. It has been shown to be an active inhibitor of squamous cell carcinoma in the laboratory. Acitretin works by inhibiting the excessive cell growth and keratinisation seen in psoriasis therefore reducing the thickening of the skin, plaque formation and scaling.</p>

<p>Peptide H-GISYGR^QL^GK^KK^HR^RR^AHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CA 19-9 (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 19-9 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-RRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal antibody - clone 1212023 is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about MERS-CoV Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Iralukast Na is a leukotriene receptor antagonist that prevents bronchoconstrictor response. It binds to the cystic fibrosis transmembrane conductance regulator (CFTR) and blocks the binding of leukotrienes, which are potent bronchoconstrictors. Iralukast Na also blocks the activity of inflammatory cells and reduces bowel inflammation. Iralukast Na has been shown to be effective in treating asthma, inflammatory bowel disease, and other autoimmune diseases.</p>

<p>(R)-Phenylephrine is a non-selective α1-adrenoceptor agonist that can be used as a bronchodilator or vasopressor. The biological effects of this compound are due to its ability to cause relaxation of smooth muscle cells and increase blood pressure by stimulating alpha-adrenergic receptors in the body. Also, this drug is used to relieve nasal discomfort caused by colds and allergies and is used to relieve sinus congestion and pressure.</p>

<p>Mouse monoclonal Pan LDH antibody</p>

<p>A co-inducer of HSP that acts through heat shock factor 1 (HSF1) in cells undergoing cellular stress. Has therapeutic potential in motor neuron degenerative diseases. Potential treatment for liposomal storage disorders, such as Niemann-Pick disease type C.</p>

<p>Ac-Asp-pNA is a carboxy, serine protease that is used as an antigen in bactericidal and antibacterial assays. It also has been shown to be effective against neutral ph organisms such as E. coli and Pseudomonas aeruginosa. Ac-Asp-pNA elutes from the column when it is inactivated under neutral ph conditions, which can be seen by the presence of reactive peaks. The protonation of Ac-Asp-pNA at high pH results in a loss of reactivity, which can be detected by the diminazene peak at low pH. This protein is activated by potassium ions and cellular proteins, which can be seen by the presence of peaks at m/z 816 and 806 respectively.</p>

<p>Mouse monoclonal Vibrio cholerae O139 antibody</p>

<p>H-KRFRQFKQAV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRFRQFKQAV-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRFRQFKQAV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRFRQFKQAV-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ALPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The nuclear transcription factor NF-kappaB up regulates gene expression during inflammation and has critical roles in carcinogenesis, anti-apoptosis, invasion, and metastasis. This has led to the search for specific inhibitors of NF-kappaB to help study NF-kappaB for possible treatments for inflammatory diseases and cancer in the future.NF-kappaB is held in an inactive state in the cytoplasm as a heterodimer containing a p65 subunit. Signalling leads to revealing of a hidden nuclear localisation sequence within p65, phosphorylation of p65, and translocation to the nucleus. p65 binds to DNA and ultimately transcription of specific genes. Therefore, finding an inhibitor of the nuclear localisation sequence and phosphorylation of the p65 subunit is an attractive target.A peptide named PTD-p65-P1 was generated from the p65 DNA binding domain mimicking the phosphorylated state, attached to a membrane-translocating peptide sequence generated from antennapedia (PTD). PTD-p65-P1 has been shown to inhibit NF-kappaB binding to DNA in a dose dependent manner. This activity was also known to be specific for NF-kappaB inhibition. The inhibition of NF-kappaB activity by PTD p65-P1 was shown to be effective against a range of stimuli including cigarette smoke, interleukin 1 and hydrogen peroxide which suggests the inhibitor acts on a common step against these stimuli. The presence of PTD p65-P1 inhibits the cytoplasmic p65 subunit phosphorylation or translocation. The reporter genes tested for NF-kappaB activity showed down regulation of gene expression in the presence of PTD-p65-P1 peptide. The evidence is compelling that this peptide could be a suitable model for a selective specific inhibitor of NF-kappaB activity for therapeutic use in the future.</p>

<p>Please enquire for more information about AF488 Anti-Phospho-NR2B (pS1303) antibody - 0.18mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide LCBiot-MKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GGVLVQPG-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-RHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Recombinant Yellow Fever virus Envelope Protein for diagnostic test manufacturers, vaccine developers and researchers globally.  Yellow fever virus, a potentially fatal mosquito-borne flavivirus, is prevalent in tropical and subtropical locations in South America and Africa. Yellow fever virus is transmitted to humans mainly by sylvatic mosquito vectors of the genera Haemagogus and Sabethes, but has also been known to be spread by the sinister Aedes aegypti mosquito which is responsible for the current Zika virus epidemic. In humans, the majority of yellow fever infections are asymptomatic; however approximately 15% of infected patients enter what is known as the toxic phase and this can lead to severe complications such as jaundice, multi-organ failure and even death. There is no specific treatment for Yellow fever and, despite access to safe and effective vaccines, the virus is still causing significant health problems in these countries. Laboratory diagnosis is generally accomplished by means of serological testing for the detection of antibodies during the postviremic phase of the disease (i.e. from the 5th day since the onset of symptoms). Yellow fever virus is difficult to diagnose, especially in the early stages, as cross-reaction with other flavivirus infections is common. There are no validated IgM ELISA kits commercially available at present and in order for yellow fever infection to be confirmed by serologically techniques, a differential diagnosis with other flavivirus infections must be carried out. Cymit Quimica's Recombinant Yellow Fever virus Envelope Protein can be used in the development of yellow fever virus diagnostic assays.</p>

<p>Peptide H-SVGGVFTSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-IHIHIYI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Anti-KCNK18/TRESK antibody - 2mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ANA Antibody Positive Human Plasma (Homogeneous) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA Antibody Positive Human Plasma (Homogeneous) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>