Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,710 products)
- Secondary Metabolites(14,222 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Itraconazole Internal Standard
<p>Itraconazole Internal Standard is a growth factor used in various biological assays and experiments. It acts as a protein kinase inhibitor, specifically inhibiting β-catenin, which plays a crucial role in cell signaling and transcription. This internal standard is commonly used in transcription-polymerase chain reaction (PCR) studies to normalize gene expression levels. Additionally, Itraconazole Internal Standard is widely utilized in the field of life sciences for its ability to inhibit collagen synthesis and activate endonucleases. Researchers also rely on this chemical reference for its cox-2 inhibitory properties, which block the production of prostaglandin endoperoxide, an important mediator of inflammation. With its potent enzymatic inhibitory effects, Itraconazole Internal Standard has become an indispensable tool in many research applications.</p>Purity:Min. 95%H-IILEALR^-OH
<p>Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNNISIIGPLDMK^-OH
<p>Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIRPKLK^WDNQ-OH
<p>Peptide H-YGGFLRRIRPKLK^WDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Progesterone 11 α-Hemisuccinate
<p>Progesterone 11 alpha-Hemisuccinate is a compound commonly used in Life Sciences research. It has been found to have various applications, including its use in the development of therapeutic drugs such as adalimumab and oncostatin. Progesterone 11 alpha-Hemisuccinate is known for its ability to bind to globulin proteins and form Hapten Conjugates, which can be used in immunoassays and diagnostic tests. Additionally, this compound has been shown to exhibit anti-vascular endothelial growth factor (anti-VEGF) activity, making it a potential candidate for anti-cancer therapies. Furthermore, progesterone 11 alpha-Hemisuccinate has been found to modulate the immune response by neutralizing autoantibodies and inhibiting the production of inflammatory cytokines such as tumor necrosis factor-alpha (TNF-α) and interferon. Overall, this compound holds promise in various fields of research and drug development due</p>Formula:C25H34O6Purity:Min. 95%Molecular weight:430.53 g/molH-G^V^Y^D^G^R^E^HT^V^-OH
<p>Peptide H-G^V^Y^D^G^R^E^HT^V^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-PFAV
<p>Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSITIRPR^-OH
<p>Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CD9 antibody
<p>CD9 antibody was raised in rabbit using residues 36-50 [RFDSQTKSIFEQETN] of the 25 kDa human protein as the immunogen.</p>Purity:Min. 95%H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
<p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C190H288N54O57Molecular weight:4,240.7 g/molOctreotide
<p>Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAVEVLKR^-OH
<p>Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYQSIR^-OH
<p>Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLSMVGPSQGR^SPSYAS-OH
<p>Peptide H-DPLSMVGPSQGR^SPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 85 (VELRQYDPVAALFFF)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,815.1 g/molH-FLPLIGRVLSGIL-NH2
<p>Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDSIICVK^-OH
<p>Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 80
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,748 g/molH-QGGFLGLSNIK^-OH
<p>Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CEPLEKQHEKERKQEEGES
<p>Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>CKMB antibody
<p>The CKMB antibody is a monoclonal antibody that is designed to target and bind to CK-MB, which is an enzyme found in human serum. This antibody has been extensively studied and proven to be highly specific for CK-MB, making it an essential tool in various research applications.</p>Purity:Min. 95%Ac-RFAAKAA-OH
<p>Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQVLVFLGQSEGLR^-OH
<p>Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TITLEVESSDTIDNVK^-OH
<p>Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-T2A antibody
<p>2A peptide-linked polycistronic vectors can be used to express multiple proteins from a single open reading frame (ORF). The small 2A peptide sequences, when cloned between genes, allows for efficient, stoichiometric production of discrete protein products within a single vector through a novel "cleavage" event within the 2A peptide sequence. 2A was discovered in the foot-and-mouth disease virus (FMDV, a picornavirus). The 2A peptide acts through ribosomal skipping to allow for the encoding of polyproteins which can dissociate into individual proteins upon translation. Anti-T2A antibody recognises 2A tagged recombinant proteins and is an excellent tool for researchers using 2A peptide based expression systems.Crude antiserum was purified by affinity chromatography using triethylamine using peptide specific antigen</p>Color and Shape:PowderH-EEAPSLRPAPPPISGGGYR^-OH
<p>Peptide H-EEAPSLRPAPPPISGGGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>δ-MSH
<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H99N21O16SMolecular weight:1,570.81 g/molRFQ Folate III Antibody Positive Serum/Plasma Pool
<p>RFQ Folate III Antibody Positive Serum/Plasma Pool is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about RFQ Folate III Antibody Positive Serum/Plasma Pool including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Sun A, N-terminal, 30 amino acid polypeptide / Sun B, N-terminal, 30 amino acid polypeptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:3,393.94 g/molAc-SPSYSPTSPS-NH2
<p>Peptide Ac-SPSYSPTSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLRGRAYGL^-OH
<p>Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pelitinib
CAS:<p>EGFR tyrosine kinase inhibitor; pro-apoptotic; antiproliferative in cancer cells</p>Formula:C24H23ClFN5O2Purity:Min. 95%Color and Shape:PowderMolecular weight:467.92 g/molKeratin pan antibody
<p>Keratin pan antibody was raised in rabbit using Keratin pan isolated from human skin as the immunogen.</p>Purity:Min. 95%HXB2 gag NO-95/aa377 - 391
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,906.3 g/molgp100 (86-95)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Morphine antibody
<p>The Morphine antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to morphine, an opioid analgesic drug commonly used for pain management. The antibody is activated when it comes into contact with morphine, allowing for precise detection and measurement.</p>H-DELLGAARQDDPTLI-OH
<p>H-DELLGAARQDDPTLI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DELLGAARQDDPTLI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DELLGAARQDDPTLI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DELLGAARQDDPTLI-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-IPAMVVDR^-OH
<p>Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAGIGILTV^-OH
<p>Peptide H-AAGIGILTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Raclopride
CAS:<p>Dopamine (D2 and D3) receptor antagonist</p>Formula:C15H20Cl2N2O3Purity:Min. 95%Color and Shape:Off-White To Yellow To Orange SolidMolecular weight:347.24 g/molWT1 126-134 mutant (HLA-A*02:01) 126Y
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C55H74N10O13SMolecular weight:1,115.3 g/molTrp-Asp-Asp
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C19H22N4O8Molecular weight:434.4 g/molFluvastatin lactone
CAS:<p>HMG-CoA reductase inhibitor</p>Formula:C24H24FNO3Purity:Min. 95%Color and Shape:PowderMolecular weight:393.45 g/molH-ESDTSYVSLK^-OH
<p>Peptide H-ESDTSYVSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ala-Tyr-Ser-Ser-Gly-Ala-Pro-Pro-Met-Pro-Pro-Phe-Pr
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C103H145N23O36S1Molecular weight:2,313.45 g/molAlbumin Goat Polyclonal Antibody, IgG Fraction
<p>Albumin Goat Polyclonal Antibody, IgG Fraction is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Albumin Goat Polyclonal Antibody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>IL3 protein
<p>Region of IL3 protein corresponding to amino acids APMTQTTSLK TSWVNCSNMI DEIITHLKQP PLPLLDFNNL NGEDQDILME NNLRRPNLEA FNRAVKSLQN ASAIESILKN LLPCLPLATA APTRHPIHIK DGDWNEFRRK LTFYLKTLEN AQAQQTTLSL AIF.</p>Purity:Min. 95%SP 2509
CAS:<p>Lysine-specific demethylase 1 ( LSD1) antagonist</p>Formula:C19H20ClN3O5SPurity:(Hplc) Min. 98.0%Color and Shape:PowderMolecular weight:437.9 g/molGAD65 555-567 (DRB1*04:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-SHAVAS-NH2
<p>Peptide Ac-SHAVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CKGGAKL-OH
<p>Peptide Ac-CKGGAKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GRTGRRNSI-NH2
<p>Peptide H-GRTGRRNSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIPGGIYNADLNDEWVQR^-OH
<p>Peptide H-IIPGGIYNADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQTLLALHR^-OH
<p>Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLWDQGNFPLIIK^-OH
<p>Peptide H-SLWDQGNFPLIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BMF protein (T7 tag)
<p>1-129 amino acids: MASMTGGQQM GRGSHMEPSQ CVEELEDDVF QPEDGEPVTQ PGSLLSADLF AQSLLDCPLS RLQLFPLTHC CGPGLRPTSQ EDKATQTLSP ASPSQGVMLP CGVTEEPQRL FYAPAEPKSC VVADPPLPAQ PCFEWRREQE RGRP</p>Purity:Min. 95%Nesfatin-1 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nesfatin-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C427H691N113O134Purity:Min. 95%Molecular weight:9,551.74 g/molStreptolysin O (SLO) Antigen, Recombinant
<p>Streptolysin O (SLO) Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Streptolysin O (SLO) Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Purity:~90% By Sds-Page And Densitometry. Major Bands Visible At 68 – 72 Kda.H-ISQAVHAAHAEINEAGR-cysteamide
<p>Peptide H-ISQAVHAAHAEINEAGR-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RKRSHAGYQTI-OH
<p>Peptide Ac-RKRSHAGYQTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AQRSPQELFHEAAQQGC-NH2
<p>Peptide Ac-AQRSPQELFHEAAQQGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENQLEVLEVSWLHGLK^-OH
<p>Peptide H-ENQLEVLEVSWLHGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TG/TPO Antibody Positive Human Plasma
<p>TG/TPO Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about TG/TPO Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-R^PKPQQFFGLM-OH
<p>Peptide H-R^PKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melanotan 1
CAS:<p>Melanocortin receptor agonist</p>Formula:C78H111N21O19Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:1,646.85 g/molCMVpp65 - 23 (NVSVNVHNPTGRSIC)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,596.8 g/molH-DSLEMTEENLADQFKDF-OH
<p>H-DSLEMTEENLADQFKDF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DSLEMTEENLADQFKDF-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DSLEMTEENLADQFKDF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DSLEMTEENLADQFKDF-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-VTLQ-NH2
<p>Peptide Ac-VTLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RF^-OH
<p>Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Rosuvastatin calcium - Bio-X ™
CAS:<p>Rosuvastatin is a drug that belongs to the group of statins. It is used for the treatment of high cholesterol and as an adjunct therapy for patients with coronary heart disease. Rosuvastatin reduces serum cholesterol by inhibiting HMG-CoA reductase, which is the rate-limiting enzyme in the production of cholesterol. Furthermore, this drug has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>Formula:C22H27FN3O6SCaPurity:(%) Min. 95%Color and Shape:PowderMolecular weight:500.57 g/molARQ 087
CAS:<p>ARQ 087 is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) on cancer cells. The EGFR plays an important role in cell proliferation. ARQ 087 blocks the binding of EGF to EGFR, inhibiting the proliferation of cancer cells and leading to tumour shrinkage. ARQ 087 has been shown to have therapeutic effects on animal models of skin cancer and solid tumours. This drug is also able to inhibit the growth of Caco2 cells, a type of human colon carcinoma cell line, as well as basic fibroblast cells from healthy individuals.</p>Formula:C29H29FN4OPurity:Min. 95%Molecular weight:468.57 g/molAc-PAINVAVHVFRKC-NH2
<p>Ac-PAINVAVHVFRKC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-PAINVAVHVFRKC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-PAINVAVHVFRKC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-PAINVAVHVFRKC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-PRSPAKLSFQFPS-NH2
<p>Peptide H-PRSPAKLSFQFPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Recombinant Pseudomonas aeruginosa Major outer membrane lipoprotein (oprI)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:12.9 g/molONO-8430506
CAS:<p>ONO-8430506 is a drug that has been shown to have physiological effects, including the induction of stem cell-like properties. It also has growth factor-like effects, including chemoresistance and acid formation. ONO-8430506 has been shown to increase insulin sensitivity in adipose tissue, as well as insulin sensitivity in cancer cells. This drug also has anti-inflammatory properties that may be due to its ability to inhibit the production of tumor necrosis factor alpha (TNF-α) and cyclooxygenase 2 (COX2). The acyl chain of this compound is an erythrocyte membrane fatty acid.</p>Formula:C27H28FN3O3Purity:Min. 95%Molecular weight:461.21147Teniposide - Bio-X ™
CAS:<p>Teniposide is a cytotoxic drug that is used in the treatment of refractory childhood acute lymphoblastic leukemia. It has antitumour activity. It is a type II topoisomerase inhibitor. This drug inhibits DNA synthesis by forming a complex with topoisomerase II and DNA.</p>Formula:C32H32O13SPurity:Min. 95%Color and Shape:PowderMolecular weight:656.65 g/molH-AGAHLQGGAK^-OH
<p>Peptide H-AGAHLQGGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LL^EAAR-OH
<p>Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGGHLDAK^-OH
<p>Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-NLVPMVATV-OH
<p>Peptide LCBiot-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSGFFVFSR^-OH
<p>Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRQIYVAAFTVQAAA-OH
<p>H-KRQIYVAAFTVQAAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRQIYVAAFTVQAAA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRQIYVAAFTVQAAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRQIYVAAFTVQAAA-OH at the technical inquiry form on this page</p>Purity:Min. 95%Neratinib - Bio-X ™
CAS:<p>Neratinib is a protein kinase inhibitor that is used in the treatment of breast cancer. This drug binds to and inhibits EGFR, HER2 and HER4. As a result of this, it prevents autophosphorylation of tyrosine residues and reduces oncogenic signalling.</p>Formula:C30H29ClN6O3Purity:Min. 95%Color and Shape:PowderMolecular weight:557.04 g/molH-QVLQVTPFAER^-OH
<p>Peptide H-QVLQVTPFAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTMAK-OH
<p>H-VTMAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTMAK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTMAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTMAK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-TLNAWVK^-OH
<p>Peptide H-TLNAWVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CEHVVRVNARVR-NH2
<p>Ac-CEHVVRVNARVR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CEHVVRVNARVR-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CEHVVRVNARVR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CEHVVRVNARVR-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Leu-Wang Resin (100-200 mesh) 1% DVB
<p>Fmoc-Leu-Wang Resin is a research tool that can be used to synthesize peptides. It is used as an activator and ligand in the production of antibodies, ion channels, and cell biology. The resin has a high purity and can be used for a variety of purposes such as pharmacology, protein interactions, and peptide synthesis. Fmoc-Leu-Wang Resin has been shown to inhibit the binding of many different proteins to their receptors.</p>Purity:Min. 95%Goat anti Rabbit IgG (HRP)
<p>Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%CMVpp65 - 67 (RPHERNGFTVLCPKN)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,768 g/molH-GPGPGGPGGAGVAR^-OH
<p>Peptide H-GPGPGGPGGAGVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>tTG IgA Positive Human Plasma
<p>tTG IgA Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about tTG IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-QDFAACGIDRMNYDSYLAQ-NH2
<p>H-QDFAACGIDRMNYDSYLAQ-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QDFAACGIDRMNYDSYLAQ-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QDFAACGIDRMNYDSYLAQ-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QDFAACGIDRMNYDSYLAQ-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-VPTIVMVDAYKRYK-OH
<p>H-VPTIVMVDAYKRYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VPTIVMVDAYKRYK-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VPTIVMVDAYKRYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VPTIVMVDAYKRYK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-GCRDGPQGIWGQDRCG-OH
<p>Peptide Ac-GCRDGPQGIWGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2
<p>Peptide Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PIIHFGSDYEDR^-OH
<p>Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 56
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,622.9 g/molH-L^SQLQTYMI^-OH
<p>Peptide H-L^SQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MREGVELCPGNKYEMRRHGT-OH
<p>H-MREGVELCPGNKYEMRRHGT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MREGVELCPGNKYEMRRHGT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MREGVELCPGNKYEMRRHGT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MREGVELCPGNKYEMRRHGT-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-TIVGALIQSVK^-OH
<p>Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PDGKKLASGCKNGQILLWDP-OH
<p>H-PDGKKLASGCKNGQILLWDP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PDGKKLASGCKNGQILLWDP-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PDGKKLASGCKNGQILLWDP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PDGKKLASGCKNGQILLWDP-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-YNESIAFFYNRSGGGGSEE-OH
<p>H-YNESIAFFYNRSGGGGSEE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YNESIAFFYNRSGGGGSEE-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YNESIAFFYNRSGGGGSEE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YNESIAFFYNRSGGGGSEE-OH at the technical inquiry form on this page</p>Purity:Min. 95%p90RSK antibody
<p>The p90RSK antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is commonly used for immunohistochemistry and protein kinase studies. This antibody specifically targets the p90RSK protein, which plays a crucial role in various cellular processes such as collagen synthesis and IFN-gamma signaling.</p>Purity:Min. 95%H-GFYAEGSR^-OH
<p>Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEIPVLPNR^-OH
<p>Peptide H-HEIPVLPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLEPPWIQVLK-OH
<p>H-CLEPPWIQVLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CLEPPWIQVLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CLEPPWIQVLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CLEPPWIQVLK-OH at the technical inquiry form on this page</p>Purity:Min. 95%5TAMRA-KKRYDREFLLGFQF-OH
<p>Peptide 5TAMRA-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEPQKFAEELIHRLERVQ-OH
<p>H-VEPQKFAEELIHRLERVQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VEPQKFAEELIHRLERVQ-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VEPQKFAEELIHRLERVQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VEPQKFAEELIHRLERVQ-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-YLTQLRRPL-OH
<p>H-YLTQLRRPL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YLTQLRRPL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YLTQLRRPL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YLTQLRRPL-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-VLTLDGMNPR-OH
<p>H-VLTLDGMNPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLTLDGMNPR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLTLDGMNPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLTLDGMNPR-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-DVNAAIAAIK^-OH
<p>Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WQEEMELYR^-OH
<p>Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSDGIFTDSYSR-OH
<p>H-HSDGIFTDSYSR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HSDGIFTDSYSR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HSDGIFTDSYSR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HSDGIFTDSYSR-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-LAEIYVNSSFYK-OH
<p>H-LAEIYVNSSFYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAEIYVNSSFYK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAEIYVNSSFYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAEIYVNSSFYK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Protein AMBP [279-290]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-YNESIAFFYNRSGGGGSKK-OH
<p>H-YNESIAFFYNRSGGGGSKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YNESIAFFYNRSGGGGSKK-OH is provided at greater that >75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YNESIAFFYNRSGGGGSKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YNESIAFFYNRSGGGGSKK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-GQELGALR-OH
<p>H-GQELGALR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQELGALR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQELGALR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQELGALR-OH at the technical inquiry form on this page</p>Purity:Min. 95%Casein Kinase II Assay Kit
<p>Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C45H73N19O24Molecular weight:1,264.2 g/molH-VTQARMVSK-OH
<p>H-VTQARMVSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTQARMVSK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTQARMVSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTQARMVSK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-GQSEVSAAQLQER^-OH
<p>Peptide H-GQSEVSAAQLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLQFGAQGSPFLK^-OH
<p>Peptide H-LFLQFGAQGSPFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPSLPTPPTREPK^-OH
<p>Peptide H-TPSLPTPPTREPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALELLMAANFLDC-OH
<p>H-ALELLMAANFLDC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALELLMAANFLDC-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALELLMAANFLDC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALELLMAANFLDC-OH at the technical inquiry form on this page</p>Purity:Min. 95%ANA IgG Positive, EBV VCA & EBNA IgG Negative EDTA Plasma
<p>ANA IgG Positive, EBV VCA & EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA IgG Positive, EBV VCA & EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>SIVmac239 - 42
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,578.8 g/molH-TTDGYLLR^-OH
<p>Peptide H-TTDGYLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISASR^-OH
<p>Peptide H-ISASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQII^NK^-OH
<p>Peptide H-VQII^NK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFPSPVDAAFR^-OH
<p>Peptide H-NFPSPVDAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AF568 TFP Ester
<p>Please enquire for more information about AF568 TFP Ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-FTITAGSK^-OH
<p>Peptide H-FTITAGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IGFBP1 antibody
<p>The IGFBP1 antibody is a monoclonal antibody that specifically targets and inhibits the activity of insulin-like growth factor binding protein 1 (IGFBP1). This antibody has antiangiogenic properties, meaning it can prevent the formation of new blood vessels. By blocking the action of IGFBP1, which is involved in endothelial growth factor signaling, this antibody can inhibit the growth and spread of certain types of tumors.</p>Vasostatin I / prepro-Chromogranin A (19-94) (Human) - I-125 Labeled
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:8,553.9 g/molH-GLEWVAR^-OH
<p>Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C.I.Acid Orange 127
CAS:<p>C.I. Acid Orange 127 is a synthetic dyestuff that is used in the textile industry as a reactive dye and as a colorant in paints, plastics, paper, leather, and textiles. It has also been used as an indicator for alkali metals. This compound reacts with an ethyl group to form a quaternary ammonium salt. The dyebath is often made of water and sodium hydroxide or potassium hydroxide at temperatures between 120-140 degrees Celsius. C.I. Acid Orange 127 is characterized by its ability to produce multicolour effects when treated with amines or carboxylates. The reactive properties of this compound make it suitable for use in dyeing wool and other animal fibres where the presence of fatty acids will increase the intensity of the colouration by C.I. Acid Orange 127.br>br></p>Purity:Min. 95%Nateglinide
CAS:<p>Nateglinide is used to treat type 2 diabetes mellitus as an oral hypoglycemic, insulinotropic agent. It is a blocker of ATP-dependent potassium channels and works by increasing the body's production of insulin, which lowers blood glucose levels. Nateglinide has been shown to be effective in reducing postprandial blood glucose levels in patients with type 2 diabetes who have not responded well to other treatments. The effects of nateglinide are reversible.</p>Formula:C19H27NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:317.42 g/molAc-KAARKSAPA-NH2
<p>Peptide Ac-KAARKSAPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Activin A human
CAS:Controlled Product<p>Activin A human is a dimeric protein, which is a member of the transforming growth factor-beta (TGF-β) superfamily. It is derived from human sources, primarily through recombinant DNA technology that allows for its precise expression and purification. Activin A plays crucial roles in a wide range of biological processes by binding to its receptors, leading to the activation of intracellular signaling pathways such as SMAD2/3 activation.The primary mode of action of Activin A involves modulating cellular growth, differentiation, and apoptosis. It exerts its effects by influencing gene expression, thereby impacting processes such as embryogenesis, inflammation, and repair mechanisms. Its influence on the regulation of erythropoiesis and iron metabolism is also significant.In scientific research, Activin A human is extensively utilized to study its role in various physiological and pathological conditions. It is instrumental in vitro to explore mechanisms underpinning cancer, reproductive biology, and immune responses. Furthermore, scientists investigate its therapeutic potential in regenerative medicine and its involvement in fibrotic diseases. The diverse functions and applications of Activin A underscore its importance as a critical factor in cellular and molecular biology research.</p>Formula:C27H34O3Purity:Min. 95%Molecular weight:406.6 g/molTetanus Toxoid Antigen
<p>Tetanus Toxoid Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Tetanus Toxoid Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-FR^-OH
<p>Peptide H-FR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACT 1004-1239
<p>ACT 1004-1239 is a peptide with an amino acid sequence of ACTLPVY. It is used as a research tool for investigating protein interactions, antibody binding, and cell biology. ACT 1004-1239 is also used as a ligand in pharmacology and life sciences to investigate the role of ion channels in the activation of receptors. The high purity of this peptide allows it to be used as an activator in biochemical assays.</p>Purity:Min. 95%Fluor-RGDK-OH
<p>Peptide Fluor-RGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>DL-Venlafaxine HCl - Bio-X ™
CAS:Controlled Product<p>Venlafaxine is an antidepressant drug used in the treatment of major depression, anxiety disorder and panic disorder. It is classed as an SNRI drug meaning it inhibits the reuptake of serotonin and norepinephrine so that there is an increased level of the neurotransmitters in the synaptic cleft.</p>Formula:C17H27NO2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:313.86 g/molTiotropium bromide - Bio-X ™
CAS:<p>Tiotropium is a bronchodilator that is used for the management of chronic obstructive pulmonary disease or COPD. It is an antimuscarinic drug that also treats asthma. Tiotropium acts mainly on M3 muscarinic receptors located in the airways to produce smooth muscle relaxation and bronchodilation.</p>Formula:C19H22BrNO4S2Purity:Min. 95%Color and Shape:PowderMolecular weight:472.42 g/molH-MPRHSRAKRAPRPSAC-NH2
<p>Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin (1-5)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C30H48N8O9Molecular weight:664.77 g/molLCBiot-EDQVDPRLIDG-OH
<p>Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H2N-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-COOH
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C31H55N11O9S1Molecular weight:757.9 g/molApoA-I antibody
<p>ApoA-I antibody was raised in goat using highly purified human Apo A-I. as the immunogen.</p>Purity:Min. 95%N-MCT
CAS:<p>N-MCT is an analog of a naturally occurring protein found in human urine that has been shown to have potent anticancer properties. It works by inhibiting specific kinases involved in cancer cell growth and promoting apoptosis, or programmed cell death, in cancer cells. N-MCT has been studied extensively for its potential as a medicinal inhibitor of tumor growth and has shown promising results in preclinical trials. This compound has the ability to disrupt the cell cycle of cancer cells, preventing them from dividing and spreading throughout the body. Its unique mechanism of action makes it a promising candidate for future cancer therapies.</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molFK18
<p>FK18 is a basic fibroblastic growth factor that has been shown to promote neuronal survival and is neuroprotective. It also can prevent glutamate-induced neurotoxicity in the central nervous system (CNS) by inhibiting glutamate release from the synaptic cleft, which leads to neuronal death. FK18 has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins and other inflammatory mediators. FK18 has also been shown to reduce necrotic cell death by decreasing mitochondrial membrane potential.</p>Formula:C107H155N31O31Purity:Min. 95%Molecular weight:2,371.62 g/molInsulin B (9-23)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C72H116N20O22SMolecular weight:1,645.9 g/molEbastine
CAS:<p>Ebastine is a H1 receptor antagonist that belongs to the group of antihistamines. Ebastine inhibits histamine release from mast cells and basophils and may also have some anticancer activity. It has been shown to be effective in clinical trials, used to treat rhinitis and allergic symptoms such as itching and watery eyes. Ebastine is also non-sedating is not metabolized by cytochrome P450 enzymes but may affect their activity due to its binding affinity for proteins such as albumin and α1-acid glycoprotein.</p>Formula:C32H39NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:469.66 g/molZorubicin
CAS:<p>Zorubicin is a drug that belongs to the group of anthracyclines. It has been used in the treatment of various solid tumours, including breast cancer and skin cancer. Zorubicin inhibits the growth of cells by binding to DNA and inhibiting the synthesis of proteins needed for cell growth. Zorubicin also inhibits energy metabolism by preventing ATP production and can cause cardiac toxicity, as well as congestive heart failure. This drug also causes damage to erythrocytes and leukocytes through its hydrophobic effect. Zorubicin is a disulfide-containing compound with a molecular weight of 727 Da. The compound is highly hydrophobic, which may be due to its ability to form hydrogen bonds with other molecules and water molecules.</p>Purity:Min. 95%Leupeptin hemisulfate
CAS:<p>Leupeptin is a protein inhibitor that binds to the ubiquitin ligases and inhibits their activity. It has been shown to inhibit the transcriptional regulation of gene expression, which is important in cancer, chronic oral administration, and experimental models. Leupeptin also blocks the binding of proteins to DNA in cell culture and animal models. This leads to decreased production of fatty acids, which are needed for cellular growth and function. Leupeptin also has an anti-depressant effect by blocking the transcriptional regulation of gene expression for serotonin receptors.</p>Formula:C20H38N6O4•(H2SO4)0Purity:Min. 90.0 Area-%Color and Shape:White PowderMolecular weight:475.59 g/molH-DGLIDPIFQER-OH
<p>H-DGLIDPIFQER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DGLIDPIFQER-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DGLIDPIFQER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DGLIDPIFQER-OH at the technical inquiry form on this page</p>Purity:Min. 95%EBV EBNA1 antibody
<p>EBV EBNA1 antibody was raised in goat using recombinant EBNA1 as the immunogen.</p>Purity:Min. 95%Amenamevir
CAS:<p>Amenamevir is an antiviral medication, which is synthesized from a chemical source. Its mode of action involves the selective inhibition of the helicase-primase complex of the varicella-zoster virus (VZV), thereby disrupting the viral DNA replication process. By specifically targeting this enzyme complex, Amenamevir impairs the viral replication machinery, leading to a reduction in viral load and amelioration of symptoms associated with infection.</p>Formula:C24H26N4O5SPurity:Min. 95%Molecular weight:482.55 g/molCangrelor tetrasodium
CAS:<p>Antagonist of P2Y12 receptor</p>Formula:C17H21Cl2F3N5O12P3S2·4NaPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:864.29Loxapine succinate
CAS:Controlled Product<p>Antagonist of dopamine (D2/D4), histamine and serotonin receptors</p>Formula:C18H18ClN3O·C4H6O4Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:445.9 g/molH-GFYFNKPTGYGSSSR^-OH
<p>Peptide H-GFYFNKPTGYGSSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RX 821002 hydrochloride
CAS:<p>RX 821002 hydrochloride is a selective serotonin reuptake inhibitor (SSRI), which is derived from synthetic chemical processes. Its mode of action involves the inhibition of serotonin reuptake into neurons, thereby increasing serotonin availability in the synaptic cleft. This mechanism enhances serotonergic neurotransmission and has profound implications for understanding mood regulation.</p>Formula:C12H14N2O3·HClPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:270.71 g/molAc-RARADADARARADADA-NH2
<p>Peptide Ac-RARADADARARADADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-L-Glu(OtBu)-Wang Resin (100-200 mesh) 1% DVB
<p>Fmoc-Glu(OtBu)-Wang Resin (100-200 mesh) 1% DVB is a synthetic resin that is used in the synthesis of peptides. It is an activator for the coupling of peptide side chains to amino acid residues. This resin has been shown to be useful as an antibody immobilization and purification agent, and can also be used as a high-purity ion channel inhibitor. Fmoc-Glu(OtBu)-Wang Resin (100-200 mesh) 1% DVB is highly soluble in water, making it an ideal material for use in life science applications such as cell biology and pharmacology.</p>Purity:Min. 95%Osteocalcin antibody
<p>The Osteocalcin antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of osteocalcin. Osteocalcin is a protein involved in bone formation and remodeling. This antibody specifically binds to osteocalcin, preventing its activation and inhibiting its function.</p>Perilipin antibody
<p>Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS</p>CLEAR-Acid Resin (100-200 mesh)
<p>CLEAR-Acid Resin (100-200 mesh) is a high purity resin that is used for peptide synthesis. It has been used in research as an activator and inhibitor of protein interactions, such as receptor-ligand and antibody-antigen. CLEAR-Acid Resin (100-200 mesh) is often used in antibody production, where it binds to the antigen and activates the immune response against it. CLEAR-Acid Resin (100-200 mesh) has also been used for ion channel research due to its ability to inhibit potassium channels in neuronal cells. The CAS Number for CLEAR-Acid Resin (100-200 mesh) is</p>Purity:Min. 95%Amyloid β peptide(1-40) trifluoroxalate - synthetic
CAS:<p>Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serum</p>Formula:C194H295N53O58S·C2HF3O2Purity:Min. 95%Color and Shape:White PowderMolecular weight:4,443.83 g/molGoat anti Mouse IgG (H + L)
<p>Goat anti Mouse IgG was raised in goat using affinity pure mouse IgG (H + L) as the immunogen.</p>Purity:Min. 95%H-TTPPVLDSDGSFFLYSR-OH
<p>Peptide H-TTPPVLDSDGSFFLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Met-Gly-Pro-AMC·HCl
CAS:<p>H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.</p>Formula:C22H28N4O5S·HClPurity:Min. 97 Area-%Color and Shape:PowderMolecular weight:497.01 g/molApoferritin
CAS:<p>Apoferritin is a type of ferritin protein that binds to iron and stores it in the form of iron-porphyrin complexes. Apoferritin has been used as a research tool to study the function of ferritins, which are involved in the regulation of iron metabolism. It also has pharmacological applications, such as an inhibitor for ion channels or an activator of ligands. Apoferritin is available in high purity and with a CAS number 9013-31-4. It can be used for research purposes in Cell Biology, Peptides, Pharmacology, Ligands, Activators, and High purity.</p>Purity:Min. 95%Color and Shape:PowderH-QGVDDAFYTLVR^-OH
<p>Peptide H-QGVDDAFYTLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-73
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,961.2 g/molCyclo[Arg-Ala-Asp-D-Tyr-Lys(PEG)]
<p>Cyclo[Arg-Ala-Asp-D-Tyr-Lys(PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Formula:C34H54N10O11Purity:Min. 95%Molecular weight:778.87 g/molH-FYFENLLAK^-OH
<p>Peptide H-FYFENLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sun A gene (2-61), 60 amino acid polypeptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Calcipotriol
CAS:<p>Calcipotriol is a vitamin D analogue that is used to treat psoriasis. It is classified as an aprotic solvent and is not soluble in water, but it dissolves in organic solvents. Calcipotriol binds to the receptor for nuclear factor kappa-B (NF-κB) and inhibits its activation, which suppresses the production of cytokines that are involved in inflammation and immune responses. The calcipotriol molecule has been shown to inhibit EGFR signaling, thereby suppressing tumor growth. This drug has also been shown to be effective in combination therapy with other drugs such as dithranol or anthralin for the treatment of psoriasis. Calcipotriol can be administered topically or by oral administration. It is usually applied twice daily and the dosage depends on the severity of the disease.</p>Formula:C27H40O3Purity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:412.6 g/molH-GPRP-NH2
<p>Peptide H-GPRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFESLK^-OH
<p>Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VASLR^-OH
<p>Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CI 988
CAS:<p>CholecystokininB (CCKB) receptor antagonist</p>Formula:C35H42N4O6Purity:Min. 95%Molecular weight:614.73 g/molJo-1 Antibody Positive Human Plasma
<p>Jo-1 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Jo-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-YGGFLRRQFK^VVT-OH
<p>Peptide H-YGGFLRRQFK^VVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Experimental Allergic Encephalitogenic Peptide (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C46H64N14O14Molecular weight:1,037.11 g/molWRN Helicase Inhibitor, NSC 19630
CAS:<p>WRN Helicase Inhibitor, NSC 19630, is a selective molecular inhibitor targeting WRN helicase, which is derived from synthetic chemical libraries. The WRN helicase, part of the RecQ helicase family, plays a critical role in DNA repair and replication processes by unwinding DNA strands. The inhibitor functions by binding to the helicase domain, obstructing its unwinding activity, and thereby interfering with the replication and repair of DNA at stalled replication forks.</p>Formula:C8H9NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:183.16 g/molH-YGGFLRRIR^PKLKWDNQ-OH
<p>Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>O151
CAS:<p>Selective and potent inhibitor of 8-oxoguanine DNA glycosylase OGG1 with IC50 of 0.6 μM. OGG1 is a key enzyme in DNA repair mechanism called base excision repair (BER). The compound inhibits the hydrolysis of glycosidic bond required for the excision of 8-oxoguanine from double stranded DNA, which leads to accumulation of mutations. It has been proposed as monotherapy for certain types of cancers as well as adjuvant for cancer therapy with DNA damaging agents. It has potential to sensitize tumours for chemotherapy and inhibit development of drug resistance mechanisms.</p>Formula:C13H15BrN2OPurity:Min. 95%Color and Shape:PowderMolecular weight:295.18 g/mol
