Biochemicals and Reagents

<p>Imiquimod is a toll-like receptor 7 agonist drug that is used for the treatment of genital warts, basal cell carcinoma and condyloma acuminata. This drug works by relieving and controlling wart production. Studies in mice have shown that this drug may induce cytokines such as interleukins. Imiquimod helps to increase apoptosis of diseased tissues and an infiltration of lymphocytes into tumor lesions.</p>

<p>Elesclomol is an investigational anticancer agent, which is a small-molecule compound. It functions by targeting the cellular oxidative stress pathway; specifically, it enhances the production of reactive oxygen species (ROS) within cancer cells. By elevating ROS levels beyond the threshold tolerable by cancer cells, Elesclomol induces apoptosis through the disruption of mitochondrial function, making it selective for environments with heightened oxidative stress.</p>

<p>Prasugrel is a thienopyridine prodrug that inhibits the enzyme ADP-dependent P2Y purinergic receptor. Prasugrel inhibits platelet aggregation and the formation of blood clots by blocking the conversion of ADP to ATP on the surface of platelets, thus preventing the release of serotonin from platelets. The reaction products formed by prasugrel are similar to those formed by clopidogrel and include hydrogen sulfate ions and a thiol-containing metabolite. It has also been shown to have potent cytotoxic activity against melanoma cells and anti-inflammatory properties. <br>Prasugrel is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>H-QAKEVLNGEMEKSRRYGAPS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QAKEVLNGEMEKSRRYGAPS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QAKEVLNGEMEKSRRYGAPS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QAKEVLNGEMEKSRRYGAPS-OH at the technical inquiry form on this page</p>

<p>H-DKTKVLVVQPKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DKTKVLVVQPKK-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DKTKVLVVQPKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DKTKVLVVQPKK-OH at the technical inquiry form on this page</p>

<p>Ac-CDADLKDVNVIPATA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDADLKDVNVIPATA-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDADLKDVNVIPATA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDADLKDVNVIPATA-OH at the technical inquiry form on this page</p>

<p>H-VNNVPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VNNVPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VNNVPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VNNVPR-OH at the technical inquiry form on this page</p>

<p>WRN Helicase Inhibitor, NSC 19630, is a selective molecular inhibitor targeting WRN helicase, which is derived from synthetic chemical libraries. The WRN helicase, part of the RecQ helicase family, plays a critical role in DNA repair and replication processes by unwinding DNA strands. The inhibitor functions by binding to the helicase domain, obstructing its unwinding activity, and thereby interfering with the replication and repair of DNA at stalled replication forks.</p>

<p>H-GYNCGGCKFGWTGPD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GYNCGGCKFGWTGPD-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GYNCGGCKFGWTGPD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GYNCGGCKFGWTGPD-OH at the technical inquiry form on this page</p>

<p>H-GGCKFGWTGPDCNRK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGCKFGWTGPDCNRK-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGCKFGWTGPDCNRK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGCKFGWTGPDCNRK-OH at the technical inquiry form on this page</p>

<p>H-GQWHLSKRDTGAGSC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQWHLSKRDTGAGSC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQWHLSKRDTGAGSC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQWHLSKRDTGAGSC-OH at the technical inquiry form on this page</p>

<p>H-VTQARMVSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTQARMVSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTQARMVSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTQARMVSK-OH at the technical inquiry form on this page</p>

<p>H-YNESIAFFYNRSGGGGSKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YNESIAFFYNRSGGGGSKK-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YNESIAFFYNRSGGGGSKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YNESIAFFYNRSGGGGSKK-OH at the technical inquiry form on this page</p>

<p>H-LAEIYVNSSFYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAEIYVNSSFYK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAEIYVNSSFYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAEIYVNSSFYK-OH at the technical inquiry form on this page</p>

<p>H-PDGKKLASGCKNGQILLWDP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PDGKKLASGCKNGQILLWDP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PDGKKLASGCKNGQILLWDP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PDGKKLASGCKNGQILLWDP-OH at the technical inquiry form on this page</p>

<p>H-MREGVELCPGNKYEMRRHGT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MREGVELCPGNKYEMRRHGT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MREGVELCPGNKYEMRRHGT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MREGVELCPGNKYEMRRHGT-OH at the technical inquiry form on this page</p>

<p>Ac-CEPQAPEMLQRARE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CEPQAPEMLQRARE-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CEPQAPEMLQRARE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CEPQAPEMLQRARE-NH2 at the technical inquiry form on this page</p>

<p>Cellubrevin antibody was raised in mouse using recombinant human cellubrevin (1-77aa) purified from E. coli as the immunogen.</p>

<p>Rho/MRTF/SRF mediated gene transcription inhibitor</p>

<p>The Human Growth Hormone antibody is a glycosylated protein that plays a crucial role in endothelial growth and development. It acts as a growth factor and interacts with androgen receptors to regulate various physiological processes. The antibody specifically targets the human growth hormone, inhibiting its activity and preventing excessive growth.</p>

<p>Deoxyribonuclease I antibody was raised in rabbit using deoxyribonuclease A isolated from bovine pancreas as the immunogen.</p>

<p>LYN antibody was raised in sheep using maltose binding protein fusion protein as the immunogen.</p>

<p>H-RPFYSNAPQEIFIQQGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RPFYSNAPQEIFIQQGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RPFYSNAPQEIFIQQGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RPFYSNAPQEIFIQQGR-OH at the technical inquiry form on this page</p>

<p>H-ISQAVHAAHAEINEAGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ISQAVHAAHAEINEAGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ISQAVHAAHAEINEAGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ISQAVHAAHAEINEAGR-OH at the technical inquiry form on this page</p>

<p>Cyfra21-1 antibody is a monoclonal antibody that specifically targets the activated form of Cyfra21-1, a tumor marker commonly found in various types of cancers. This antibody has been extensively studied in the field of life sciences and has shown promising results as a potential therapeutic agent. It works by binding to the Cyfra21-1 protein and inhibiting its activity, thereby preventing the growth and spread of cancer cells. Additionally, this antibody has been found to have inhibitory effects on other growth factors such as fibrinogen and adrenomedullin. It also exhibits multidrug resistance reversal properties, making it a valuable tool in cancer treatment. With its unique mechanism of action and high specificity, Cyfra21-1 antibody holds great potential for targeted cancer therapy.</p>

<p>RSV antibody was raised in mouse using RSV as the immunogen.</p>

<p>ApoC-II protein is a vital component of the human body that plays a crucial role in various biological processes. It acts as an epidermal growth factor and is involved in the regulation of cell growth and development. This protein has been extensively studied in Life Sciences, and its importance has been recognized in various research fields. The antigen binding domain of ApoC-II protein allows it to interact with specific molecules, facilitating an antigen-antibody reaction. This property makes it an ideal candidate for use in immunoassays and bioassays, where its binding affinity can be utilized for diagnostic purposes. Furthermore, ApoC-II protein has shown promising results in studies related to microvessel density and growth factor activity. Its ability to modulate these factors makes it a potential target for therapeutic interventions aimed at promoting tissue regeneration and wound healing. In addition to its biological functions, ApoC-II protein is also widely used in scientific research as a tool for studying molecular interactions. Monoclon</p>

<p>H-CEPVVPNAPPAYEKL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CEPVVPNAPPAYEKL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CEPVVPNAPPAYEKL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CEPVVPNAPPAYEKL-OH at the technical inquiry form on this page</p>

<p>Bovine IgG is an immunoglobulin that plays a crucial role in the immune response. It acts as an inhibitory factor for oncostatin, a cytokine involved in cell growth and differentiation. Bovine IgG is commonly used in research laboratories for various applications, including the production of monoclonal antibodies and polyclonal antibodies. It can be used as a control or standard in immunoassays to measure the concentration of specific proteins or analytes. Bovine IgG is also used in the field of life sciences for studying various biological processes, such as signal transduction, gene expression, and protein interactions. With its high purity and stability, bovine IgG is an essential component in many experimental protocols.</p>

<p>Myoglobin antibody was raised in mouse using human Myoglobin as the immunogen.</p>

<p>Region of IL1 beta protein corresponding to amino acids APVRSLNCTL RDSQQKSLVM SGPYELKALH LQGQDMEQQV VFSMSFVQGE ESNDKIPVAL GLKEKNLYLS CVLKDDKPTL QLESVDPKNY PKKKMEKRFV FNKIEINNKL EFESAQFPNW YISTSQAENM PVFLGGTKGG QDITDFTMQF VSS.</p>

<p>Purified native Human CEA protein (Preservative-free)</p>

<p>Complement C3 antibody is a highly specialized product designed to target and neutralize the complement protein C3. This antibody has been extensively tested and proven effective in laboratory studies. It has shown high affinity for C3 and can effectively block its activity.</p>

<p>Conjugated Triiodothyronine-HRP hapten</p>

<p>Inhibitor of the fatty acid amide hydrolase FAAH-4. The FAAH-4 inhibition with WWL 154 prevents the breakdown of 2-arachidonoylgycerol (2-AG), prolongs lifespan in Caenorhabditis elegans and protects from oxidative stress.</p>

<p>Selective inhibitor of the mutated RET variant RETV804M, which is the anticipated drug-resistant RET mutant that can occur in tumours treated with kinase inhibitors. The compound has a biochemical IC50 of 0.02 µM and selectivity for purified RETV804M over purified RET and KDR of 3.7 and 110, respectively. The efficacy of the compound was shown also in cell cultures with IC50 of 4.4 µM, and cell assay selectivity for RETV804M over RET and KDR of 0.89 and 2.3, respectively.</p>

<p>Purified native Human beta 2 Microglobulin protein</p>

<p>Clopidogrel is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>

<p>Amiodarone a class III anti-arrhythmic agent, used to treat and prevent certain types of irregular heartbeats. It is a competitor for natural ligands of alpha and beta adrenergic receptors, muscarinic acetylcholine receptors, histamine H1 receptors, and serotonin 5HT2A/5HT2C receptors. Amiodarone has been shown to reduce the number of atrial and ventricular arrhythmias in patients with structural heart disease, and has been used to treat atrial fibrillation, ventricular tachycardia, and Wolff-Parkinson-White Syndrome. It has also been used in the prevention of myocardial infarcts due to its ability to modify blood pressure and maintain cardiac function. In addition, amiodarone inhibits prostaglandin synthesis by inhibiting cyclooxygenase enzymes. This prevents inflammation in the gastrointestinal tract and reduces bowel disease symptoms such as cramping or diarrhea.</p>

<p>Inhibitor of VEGF receptor tyrosine kinases and non-receptor tyrosine kinases</p>

<p>Dopamine (D2) receptor antagonist; 5-HT4 serotonin receptor agonist</p>

<p>Solenopsin is used as a research tool in the study of ion channels. It has been shown to inhibit potassium channels and activate calcium channels, which are important for nerve transmission. Solenopsin binds to cell-surface receptors, such as the nicotinic acetylcholine receptor, which causes an influx of calcium ions into cells.</p>

<p>Polyclonal Bacillus anthracis antibody (Protective Antigen), Anti-Bacillus anthracis antibody (Protective Antigen), Bacillus anthracis PA antibody, Anthrax PA antibody, Bacillus anthracis Protective Antigen antibody, Anthrax Protective Antigen antibody</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, a potent antituberculosis drug from the rifamycin class. Designed to combat tuberculosis infection, this active compound exhibits remarkable bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Tested using advanced techniques like the patch-clamp technique on human erythrocytes, this drug has shown high efficacy in treating tuberculosis. Metabolized through various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers comprehensive treatment against Mycobacterium strains. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indoxyl</p>

<p>Aflatoxin B antibody was raised in Mouse using Raised against aflatoxin of Aspergillus flavus origin as the immunogen.</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>CEA antibody (HRP) was raised in goat using affinity pure human CEA as the immunogen.</p>

<p>IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE</p>

<p>NKX2-5 antibody was raised in Rabbit using Human NKX2-5 as the immunogen</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has demonstrated its high efficacy using advanced techniques such as the patch-clamp technique on human erythrocytes. In addition, this drug undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Pro-Collagen I antibody was raised in mouse using human procollagen I as the immunogen.</p>

<p>TGF alpha antibody was raised in mouse using 17-amino acid synthetic peptide from carboxyl-terminus of rat TGF-alpha as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AHSG antibody, catalog no. 70R-5916</p>

<p>Streptococcus Group B antibody was raised in mouse using Group B Streptococcus as the immunogen.</p>

<p>Rabbit polyclonal Ergocryptine antibody</p>

<p>Chikungunya virus antibody is a highly effective solution for combating the Chikungunya virus. This antibody specifically targets and neutralizes the virus, preventing its replication and spread within the body. It works by binding to collagen, which is present on the surface of infected cells, effectively blocking the virus from entering healthy cells.</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>The alpha Actin antibody is a monoclonal antibody that specifically targets and binds to alpha actin, a protein involved in muscle contraction. This antibody has various characteristics and applications in the field of Life Sciences. It can be used for research purposes to study the role of alpha actin in different biological processes. One of the key characteristics of this antibody is its cytotoxic activity. It has been shown to have a potent cytotoxic effect on human hepatocytes, inhibiting their growth and inducing cell death. This makes it a valuable tool for studying the mechanisms underlying liver diseases and potential therapeutic interventions. Additionally, the alpha Actin antibody has been found to have anti-vascular endothelial growth factor (anti-VEGF) properties. VEGF is a protein that promotes the formation of new blood vessels, and its overexpression is associated with various diseases, including cancer. By blocking VEGF activity, this antibody may help inhibit angiogenesis and tumor growth. Furthermore, this monoclonal antibody has</p>

<p>Insulin antibody is a monoclonal antibody that has inhibitory properties against insulin. It acts by binding to insulin and preventing its activation, thereby inhibiting its function in the body. This antibody has been shown to have inhibitory effects on various processes, including nuclear signaling pathways, chemokine production, interferon release, collagen synthesis, and the production of autoantibodies. Additionally, insulin antibody has been found to inhibit the activity of TGF-β1, a cytokine involved in cell growth and immune responses. In the field of Life Sciences, this antibody is commonly used in research studies involving insulin-related pathways and metabolism. It has also been utilized in liver microsome studies to investigate drug interactions and metabolic processes.</p>

<p>Phosphoserine antibody was raised in rabbit using phosphoserine-KLH and phosvitin mixture as the immunogen.</p>

<p>GARS antibody was raised in Rabbit using Human GARS as the immunogen</p>

<p>Region of M-CSF protein corresponding to amino acids MKEVSEHCSH MIGNGHLKVL QQLIDSQMET SCQIAFEFVD QEQLDDPVCY LKKAFFLVQD IIDETMRFKD NTPNANATER LQELSNNLNS CFTKDYEEQN KACVRTFHET PLQLLEKIKN FFNETKNLLE KDWNIFTKNC NNSFAKCSSR DVVTKP.</p>

<p>OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) (HRP) was raised in goat using rat IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>Purified recombinant Treponema pallidum TmpA protein</p>

<p>Mouse IgG is a monoclonal antibody that is widely used in Life Sciences research. It specifically binds to epidermal growth factor and insulin, making it an essential tool for studying the functions of these molecules. Mouse IgG is commonly used in experiments involving immunoprecipitation, Western blotting, and immunohistochemistry. This purified immunoglobulin has been extensively characterized and validated for its high specificity and affinity. It can be used to detect and quantify various targets, including antigens, autoantibodies, and specific proteins such as HER2 (human epidermal growth factor receptor 2). Additionally, Mouse IgG can be conjugated with different labels or enzymes to facilitate detection or purification processes. Its versatility and reliability make it an indispensable reagent in many areas of research, including cell biology, immunology, and molecular biology.</p>

<p>Dinitrophenol antibody was raised in goat using dinitrophenol-modified protein as the immunogen.</p>

<p>Neisseria gonorrhoeae antibody was raised in rabbit using a whole cell preparation of Neisseria gonorrhoeae; ATCC 31426 as the immunogen.</p>

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.</p>

<p>Purified native Rabbit ACE protein</p>

<p>Region of FGF10 protein corresponding to amino acids MLGQDMVSPE ATNSSSSSFS SPSSAGRHVR SYNHLQGDVR WRKLFSFTKY FLKIEKNGKV SGTKKENCPY SILEITSVEI GVVAVKAINS NYYLAMNKKG KLYGSKEFNN DCKLKERIEE NGYNTYASFN WQHNGRQMYV ALNGKGAPRR GQKTRRKNTS AHFLPMVVHS.</p>

<p>CYP2C8 + CYP2C9 + CYP2C19 antibody was raised in rabbit using a synthetic peptide as the immunogen.</p>

<p>Purified recombinant Human ACADM protein</p>

<p>Purified Rat IgG (Fab)</p>

<p>Streptococcus Pneumoniae antibody was raised in mouse using the Streptococcus pneumoniae common C-polysaccharide as the immunogen.</p>

<p>Human Serum Albumin protein is a versatile protein widely used in the Life Sciences field. It serves as an enzyme substrate, making it valuable for various research applications. This protein has neutralizing properties and contains histidine residues that can be activated to bind to specific molecules. Human Serum Albumin also acts as an anticoagulant, preventing blood from clotting.</p>

<p>Human IgM antibody was raised in mouse using purified human serum IgM as the immunogen.</p>

<p>Dengue type 2 antibody was raised in mouse using dengue type 2, (New Guinea C), as the immunogen.</p>

<p>Quinidine antibody was raised in mouse using quinidine conjugated to KLH as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:</p>

<p>FKBP3 antibody was raised in mouse using recombinant Human Fk506 Binding Protein 3, 25Kda (Fkbp3)</p>

<p>The HCG antibody is a highly specialized product that offers a range of unique characteristics and applications in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize and inhibit the activity of human chorionic gonadotropin (HCG), a hormone that plays a crucial role in pregnancy.</p>

<p>Candida albicans antibody was raised in rabbit using Candida albicans, type A as the immunogen.</p>

<p>GSTA1 antibody was raised in Rabbit using Human GSTA1 as the immunogen</p>

<p>The cMyc antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and neutralizes the cMyc protein, which plays a crucial role in cell growth and proliferation. This antibody is commonly used in various applications such as immunoassays, protein kinase assays, and Western blotting to study the functions of cMyc and its involvement in different cellular processes.</p>

<p>Streptolysin O protein is a monoclonal antibody that belongs to the category of Recombinant Proteins &amp; Antigens. It is designed to target specific molecules and has been found to be effective in neutralizing autoantibodies. Streptolysin O protein exhibits cytotoxic properties and has been shown to have an impact on collagen and adipose tissues. This protein is also involved in various biological processes, such as the regulation of glucagon and galectin-3, which are important for glucose metabolism and cell adhesion. In addition, Streptolysin O protein plays a role in interferon signaling pathways. Its unique properties make it a valuable tool for research in the field of Life Sciences.</p>

<p>Human IgM antibody was raised in mouse using immunoglobulin M Fab region as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBP tag antibody, catalog no. 70R-12226</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. With its specific binding ability to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.</p>

<p>The CRP antibody is a highly specialized drug antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to neutralize and immobilize agonist proteins, thereby inhibiting their activity. This antibody is buffered and activated to ensure optimal performance and efficacy.</p>

<p>Purified recombinant HBsAg protein (Subtype ayw)</p>

<p>Adenovirus antibody was raised in goat using hexon from ADV, type 2 as the immunogen.</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>The CD44 antibody is a highly reactive monoclonal antibody that targets the CD44 protein, which is involved in cell adhesion and migration. It specifically recognizes the acid residues of CD44 and has been shown to have neuroprotective and neurotrophic effects. In Life Sciences research, this antibody is commonly used to study the role of CD44 in various cellular processes, including collagen binding and insulin signaling. It can also be used as a diagnostic tool for detecting autoantibodies in human serum. With its high specificity and affinity, the CD44 antibody is a valuable tool for researchers studying glial fibrillary acidic proteins and other related proteins.</p>

<p>JNK1 antibody was raised in sheep using purified JNK-1 yeast fusion protein as the immunogen.</p>

<p>HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.</p>

<p>COVID-19 Nucleocapsid protein recombinant Antigen</p>

<p>The PKM2 antibody is a highly specialized monoclonal antibody that has a strong affinity for the pyruvate kinase M2 isoform. This antibody binds specifically to the receptor sites of PKM2, inhibiting its activity and preventing the conversion of phosphoenolpyruvate (PEP) to pyruvate. As a result, glycolysis is disrupted, leading to decreased ATP production and altered metabolic pathways.</p>

<p>The CREST antibody is a monoclonal antibody that specifically targets transthyretin, a protein involved in various biological processes. This antibody is widely used in Life Sciences research and diagnostics. It can be used in a variety of applications, including immunohistochemistry, western blotting, and ELISA assays. The CREST antibody has been shown to effectively bind to transthyretin in human hepatocytes and other cell types. It can also be used as an electrode for electrochemical analysis or as a tool for antibody-mediated cytotoxicity studies. With its high specificity and binding affinity, the CREST antibody is an essential tool for researchers studying transthyretin-related diseases and exploring therapeutic options.</p>

<p>Troponin I antibody is a specialized antibody used in Life Sciences research. It is designed to target and bind to troponin I, a protein found in cardiac muscle tissue. This antibody specifically recognizes troponin I dimers and can be used for various applications such as immunohistochemistry, western blotting, and ELISA assays. Troponin I antibody plays a crucial role in the detection and quantification of troponin I levels, which are important indicators of heart damage or myocardial infarction. It has been extensively used in studies related to cardiovascular diseases and has shown excellent specificity and sensitivity. This monoclonal antibody is highly effective in neutralizing the effects of interferon-gamma (IFN-gamma) and superoxide production induced by IFN-gamma. With its high affinity for troponin I, this antibody is an invaluable tool for researchers studying cardiac function and disease mechanisms.</p>

<p>Clostridum difficile toxin A antibody was raised in mouse using toxin/toxoid A of Clostridium difficile as the immunogen.</p>

<p>The Flk1 antibody is a monoclonal antibody that targets the Flk1 protein, also known as vascular endothelial growth factor receptor 2 (VEGFR-2). This antibody specifically binds to the Flk1 protein and can be used for various research applications.</p>

<p>Phycoerythrin dye is a versatile and highly stable fluorescent dye commonly used in Life Sciences research. It is widely employed in various applications, including flow cytometry, immunohistochemistry, and fluorescence microscopy. This dye offers exceptional photostability, ensuring accurate and reliable results even under intense illumination. Phycoerythrin dye can be conjugated to a variety of molecules such as monoclonal antibodies or growth factors, allowing for specific targeting and detection of cellular components or biomarkers. Its bright emission enables the visualization of cellular structures or processes with high sensitivity. Additionally, Phycoerythrin dye can be used as a blocking agent and/or inhibitor in assays to prevent non-specific binding or interference from other substances. With its broad range of applications and outstanding performance characteristics, Phycoerythrin dye is an indispensable tool for researchers in the field of Life Sciences.</p>

<p>Purified native Rabbit Actin protein</p>

<p>Peanut Conglutin Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Peanut Conglutin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Von Willebrand Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Von Willebrand Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>FLAG peptide</p>

<p>Neurofilament Light Chain (NfL) Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neurofilament Light Chain (NfL) Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Region of IL8 protein corresponding to amino acids AVLPRSAKEL RCQCIKTYSK PFHPKFIKEL RVIESGPHCA NTEIIVKLSD GRELCLDPKE NWVQRVVEKF LKRAENS.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it undergoes metabolization. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Legionella pneumophila (serogroup 1) antibody was raised in mouse using Legionella pneumophila antigenic subgroup knoxville 1 as the immunogen.</p>

<p>IGF1 antibody was raised in goat using highly pure recombinant murine IGF-I as the immunogen.</p>

<p>Mumps virus protein is a chemokine that plays a crucial role in various biological processes. It contains tyrosine residues that are essential for its function, including the activation of caspase-9 and inhibition of EGFR protein. This protein also stimulates endothelial growth and has been found to interact with epidermal growth factor. Native Proteins &amp; Antigens offers monoclonal antibodies specifically designed to target this protein, making it an invaluable tool for research in the field of life sciences. These antibodies have shown neutralizing activity against mumps virus, providing valuable insights into the mechanisms of viral infection and potential therapeutic interventions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been proven through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it has the ability to bind to markers expressed in high levels in Mycobacterium tuberculosis strains and inhibit cell growth in culture.</p>

<p>Influenza B antibody was raised in mouse using a nuclear protein from the Singapore strain of influenza B as the immunogen.</p>

<p>Please enquire for more information about Peptide M trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rupatadine is a dual histamine H1 receptor and platelet activating factor antagonist that is used for the treatment of allergic rhinitis. It can also be used for the treatment of chronic spontaneous urticaria. This drug inhibits the H1 receptor and the platelet activating factor receptor from carrying out their roles resulting in a reduction in the symptoms of allergic rhinitis.</p>

<p>Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.</p>

<p>TSH antibody was raised in mouse using huma pituitary TSH as the immunogen.</p>

<p>PSA antibody was raised in mouse using human PSA from seminal plasma as the immunogen.</p>

<p>tPA antibody was raised in goat using single chain human TPA isolated from malignant melanoma (Bowes) cell culture as the immunogen.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>MMP3 antibody was raised in mouse using APMA (4-Aminophenylmercuric acetate) activated human stromelysin-1 (SL-1) as the immunogen.</p>

<p>Purified Recombinant Renin 1 protein (His tagged)</p>

<p>The NSE protein is a native protein and antigen that plays a crucial role in various biological processes. It acts as a superoxide scavenger, protecting cells from oxidative damage. Additionally, it serves as a substrate for protein kinases, including the c-myc oncogene product. In the field of life sciences, NSE protein is widely used in research involving proteins and antigens. It can be expressed using plasmids and has high affinity for ribosomal binding. Monoclonal antibodies against NSE protein are available and commonly used in studies related to antiphospholipid antibodies and tyrosine activation. Furthermore, NSE protein has been implicated in the pathogenesis of neurodegenerative disorders such as alpha-synucleinopathies and collagen-related diseases. Its multifunctional nature makes it an essential component in various scientific investigations.</p>

<p>Purified native Human CRP protein</p>

<p>FABP antibody was raised in mouse using human heart FABP as the immunogen.</p>

<p>Troponin I antibody (cardiac) was raised in mouse using human cardiac troponin I (N-Terminal) as the immunogen.</p>

<p>Rabbit polyclonal Annexin A6 antibody</p>

<p>Purified Hamster IgG (Fab'2)</p>

<p>E2F6 antibody was raised in mouse using recombinant Human E2F Transcription Factor 6, Transcript Variant A</p>

<p>Conjugated Benzoylecgonine-BSA hapten</p>

<p>Purified recombinant Treponema pallidum TmpA protein</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA</p>

<p>Purified recombinant Mycobacterium tuberculosis ESAT6 Protein (His tag)</p>

<p>The E.Coli derived 52.2 kDa recombinant protein contains the CMV Pp65 (UL83) immunodominant regions, 297-510 amino acids. Recombinant CMV-Pp65 is fused to a 26 kDa GST tag.</p>

<p>Goat anti-bovine IgG (H + L) (HRP) was raised in goat using bovine IgG (H &amp; L) as the immunogen.</p>

<p>Partially purified CA 50 protein from cell culture concentrate</p>

<p>NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL</p>

<p>Hexylcaine Hydrochloride (USP grade powder) chemical reference substance</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Region of TGF beta 1 protein corresponding to amino acids ALDTNYCFSS TEKNCCVRQL YIDFRKDLGW KWIHEPKGYH ANFCLGPCPY IWSLDTQYSK VLALYNQHNP GASAAPCCVP QALEPLPIVY YVGRKPKVEQ LSNMIVRSCK CS.</p>

<p>Goat anti-Bovine IgG (H + L) (biotin) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

<p>Troponin I antibody (Cardiac) was raised in mouse using animo acid residues 41-49 of cTnI as the immunogen.</p>

<p>The VEGFR1 antibody is a highly specialized monoclonal antibody that targets the vascular endothelial growth factor receptor 1 (VEGFR1). It works by neutralizing the activity of VEGFR1, which plays a crucial role in angiogenesis and blood vessel formation. This antibody has been extensively used in Life Sciences research to study the effects of VEGFR1 inhibition on various physiological processes.</p>

<p>The CKMB antibody is a highly specialized product used in the field of Life Sciences. It belongs to the class of Antibodies and specifically targets CKMB dimers. This Monoclonal Antibody is designed to immobilize and neutralize activated CKMB, which is crucial for accurate diagnostic testing.</p>

<p>SHBG antibody was raised in goat using human sex hormone binding globulin as the immunogen.</p>

<p>Ile-Pro-Pro (IPP) has the ability to inhibit angiotensin-converting enzyme and stimulate the production of nitric oxide. It could be used to improve hypertension thus reducing the risk of cardiovascular diseases.</p>

<p>Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (250-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.</p>