Biochemicals and Reagents

<p>Lenvatinib is a tyrosine kinase inhibitor that is used to treat cancers such as solid tumours. This drug inhibits the activity of VEGR receptors. It also inhibits other receptors such as fibroblast growth factor.</p>

<p>H-LTVQGQPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LTVQGQPK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LTVQGQPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LTVQGQPK-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about anti-Mouse IgM Antibody (Rabbit) - Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Alpha 1-Acid Glycoprotein Reference Serum</p>

<p>Rat Vitamin D Binding Protein Reference Serum</p>

<p>Ac-CSAYLSRPSPFDLFIRKS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSAYLSRPSPFDLFIRKS-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSAYLSRPSPFDLFIRKS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSAYLSRPSPFDLFIRKS-NH2 at the technical inquiry form on this page</p>

<p>Please enquire for more information about anti-beta Galactosidase Antibody (Chicken) - Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human SAA Reference Serum</p>

<p>H-SVGIVTTTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVGIVTTTR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVGIVTTTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVGIVTTTR-OH at the technical inquiry form on this page</p>

<p>O6-Benzylguanine is a guanine analog that is an antineoplastic agent. It works by acting as a suicide inhibitor of the enzyme O6-alkylguanine-DNA alkyltransferase. This results to an interruption of DNA repair so that damage can occur to local tumor targets.</p>

Irinotecan hydrochloride trihydrate is a topoisomerase I inhibitor that is used as chemotherapy drug for colorectal cancer. By inhibiting topoisomerase I, Irinotecan hydrochloride trihydrate prevents the replication of DNA in cells, and stops the cancer cells from growing and dividing. When used for chemotherapy, Irinotecan hydrochloride trihydrate is usually part of combination therapy with other chemotherapy drugs, such as 5-fluorouracil (5-FU) and leucovorin for other cancers.

<p>Please enquire for more information about RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Hemoglobin Reference Serum</p>

<p>H-CNEKGMCSRRKESSD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CNEKGMCSRRKESSD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CNEKGMCSRRKESSD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CNEKGMCSRRKESSD-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about RF Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CCP Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Low Hemolyzed Human Plasma from Cadaver including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>H-CGGSAYLSRPSPFD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGSAYLSRPSPFD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGSAYLSRPSPFD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGSAYLSRPSPFD-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about Troponin T Positive Human Plasma (Li Heparin) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-GQQQGLPRAAGGSVC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQQQGLPRAAGGSVC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQQQGLPRAAGGSVC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQQQGLPRAAGGSVC-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about Beta-2-Glycoprotein-1 IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about SSA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ziprasidone is an atypical antipsychotic drug that is used to manage schizophrenia, bipolar mania, and agitation. This drug binds to serotonin and dopamine receptors. As a result it enhances modulation of mood and improves overall cognition.</p>

<p>Please enquire for more information about EBV VCA IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Prostaglandin E1 analog; agonist of EP2, EP3 and EP4 receptors</p>

<p>Please enquire for more information about SARS-CoV-2/Flu A/Flu B/RSV Negative Human Nasopharyngeal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AZD3965 is a potent, selective and orally available monocarboxylate transporter 1 (MCT1) inhibitor with binding affinity of 1.6 nM, 6-fold selective for MTC1 over MCT2.</p>

<p>H-EFFTKNSAFPKTTNG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EFFTKNSAFPKTTNG-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EFFTKNSAFPKTTNG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EFFTKNSAFPKTTNG-OH at the technical inquiry form on this page</p>

<p>H-AWCRQLGEKGPCQRVVSTHN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AWCRQLGEKGPCQRVVSTHN-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AWCRQLGEKGPCQRVVSTHN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AWCRQLGEKGPCQRVVSTHN-OH at the technical inquiry form on this page</p>

<p>H-YEFLNGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YEFLNGR-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YEFLNGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YEFLNGR-OH at the technical inquiry form on this page</p>

<p>Inhibitor of cytochrome P450; inhibitor of prostaglandin synthesis</p>

<p>H-NERVWIALNSNLTDNQYT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NERVWIALNSNLTDNQYT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NERVWIALNSNLTDNQYT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NERVWIALNSNLTDNQYT-OH at the technical inquiry form on this page</p>

<p>Ac-CKGPNVAAIVGGTVV-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CKGPNVAAIVGGTVV-NH2 is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CKGPNVAAIVGGTVV-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CKGPNVAAIVGGTVV-NH2 at the technical inquiry form on this page</p>

<p>Imiquimod is a toll-like receptor 7 agonist drug that is used for the treatment of genital warts, basal cell carcinoma and condyloma acuminata. This drug works by relieving and controlling wart production. Studies in mice have shown that this drug may induce cytokines such as interleukins. Imiquimod helps to increase apoptosis of diseased tissues and an infiltration of lymphocytes into tumor lesions.</p>

<p>Nf-κβ activator 1 is a peptide that has been used as a research tool in the fields of cell biology, pharmacology and immunology. The peptide is an activator of NF-κβ and can be used to study protein interactions, receptor binding, ligand binding and ion channel activity. Nf-κβ activator 1 has been shown to function as an antagonist at the angiotensin II type 2 receptor (AT2R) in vitro. It binds to AT2R with high affinity and specificity, acting as a competitive inhibitor of the AT2R.</p>

<p>Inhibitor of ataxia telangiectasia mutated (ATM) kinase and AKT kinase with anti-cancer activity. ATM is a nuclear protein kinase and a signal transducer sensing DNA damage as well as controlling double strand DNA break (DSB) repair. It is a radiotherapy and chemotherapy sensitizer, especially in tumors sensitive to DNA alkylating agents (such as temozolomide). Moreover, KU 55933 inhibits phosphorylation of cytoplasmic AKT kinase, downregulates synthesis of cyclin D1 and induces cell cycle arrest in G1 phase.</p>

<p>Cyclo[Arg-Ala-Asp-D-Tyr-Lys(PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.</p>

<p>Alpha-Mating Factor acetate salt is a complex compound that is a useful intermediate, building block, and reaction component. Alpha-Mating Factor acetate salt has been shown to be a useful scaffold for the synthesis of other compounds. It can also be used as a reagent in research or as a speciality chemical. Alpha-Mating Factor acetate salt is soluble in water and most organic solvents, making it versatile in its applications.</p>

<p>Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serum</p>

<p>Serotonin 5-HT4 receptor agonist</p>

<p>H-GYNCGGCKFGWTGPD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GYNCGGCKFGWTGPD-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GYNCGGCKFGWTGPD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GYNCGGCKFGWTGPD-OH at the technical inquiry form on this page</p>

<p>H-GGCKFGWTGPDCNRK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGCKFGWTGPDCNRK-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGCKFGWTGPDCNRK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGCKFGWTGPDCNRK-OH at the technical inquiry form on this page</p>

<p>H-GQWHLSKRDTGAGSC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQWHLSKRDTGAGSC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQWHLSKRDTGAGSC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQWHLSKRDTGAGSC-OH at the technical inquiry form on this page</p>

<p>H-VTQARMVSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTQARMVSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTQARMVSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTQARMVSK-OH at the technical inquiry form on this page</p>

<p>H-YNESIAFFYNRSGGGGSKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YNESIAFFYNRSGGGGSKK-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YNESIAFFYNRSGGGGSKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YNESIAFFYNRSGGGGSKK-OH at the technical inquiry form on this page</p>

<p>H-LAEIYVNSSFYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAEIYVNSSFYK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAEIYVNSSFYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAEIYVNSSFYK-OH at the technical inquiry form on this page</p>

<p>H-TTSEYQVLVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TTSEYQVLVR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TTSEYQVLVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TTSEYQVLVR-OH at the technical inquiry form on this page</p>

<p>Promethazine is an antihistamine drug that is used to treat allergic conditions, nausea and vomiting. This drug is an antagonist of histamine receptors and NDMA receptors. Antagonism of NDMA receptors help to aid in better sleep and anxiety relief. Additionally, antagonism of histamine receptors aid in preventing nausea and vomiting.</p>

<p>Purified Goat IgG (Fab'2)</p>

<p>THC antibody was raised in mouse using delta-8-THC-BSA as the immunogen.</p>

<p>Dual PI3K/mTOR inhibitor</p>

<p>Purified COVID-19 Nucleoprotein Antibody</p>

<p>Complement C4 antibody was raised in goat using human C4 complement as the immunogen.</p>

<p>Factor V antibody was raised in mouse using human factor V as the immunogen.</p>

<p>HBsAg antibody was raised in mouse using highly purified hepatitis B surface antigen as the immunogen.</p>

<p>H-AMVALIDVFHQYSGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AMVALIDVFHQYSGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AMVALIDVFHQYSGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AMVALIDVFHQYSGR-OH at the technical inquiry form on this page</p>

<p>H-GFPEAARKG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GFPEAARKG-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GFPEAARKG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GFPEAARKG-OH at the technical inquiry form on this page</p>

<p>Inhibitor of serine proteinases such as trypsin and plasmin</p>

<p>Inhibitor of histone deacetylase 3 (HDAC3) with IC50 in nanomolar range. BRD 9908 was shown to preserve the insulin-secreting pancreatic cells in nonobese diabetic mice. BRD 3308 supressed infiltration of mononuclear cells and prevented β-cell death in vivo as well as increased basal insulin secretion in vitro. Studies on HIV infection models showed that HDAC3 inhibition by BRD 3308 disrupts the HIV latency by increasing the gene expression from HIV promoter.</p>

<p>Rapamycin is a macrolide antibiotic that has been studied as a potential anticancer agent. It binds to FK506 binding proteins (FKBPs) to form a complex that inhibits mammalian targets of rapamycin (mTOR). Rapamycin also blocks p70 S6 kinase activation by interleukin-2 and thereby inhibits proliferation of T cells. It induces differentiation of human pluripotent stem cells (hPSCs) to mesendoderm and blood progenitor cells.</p>

<p>Selective, potent, competitive and reversible inhibitor of human 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD-1) with IC50 of 2.3 nM and more than 10000-fold selectivity over the related 11β-HSD-2 isoform. BMS 823778 inhibits conversion of cortisone in cortisol and has applications in the treatment of diabetes type 2 since it can influence the occurrence of insulin resistance.</p>

<p>H-LAAWTSSGP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAAWTSSGP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAAWTSSGP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAAWTSSGP-OH at the technical inquiry form on this page</p>

<p>H-KLTPLCVTLDCTNAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KLTPLCVTLDCTNAT-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KLTPLCVTLDCTNAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KLTPLCVTLDCTNAT-OH at the technical inquiry form on this page</p>

<p>H-KGMLLEQSQSPYPAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KGMLLEQSQSPYPAL-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KGMLLEQSQSPYPAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KGMLLEQSQSPYPAL-OH at the technical inquiry form on this page</p>

<p>Nitrogen mustard derivative; DNA crosslinking agent; anti-cancer agent</p>

<p>Purified native Human beta 2 Microglobulin protein</p>

<p>Exatecan Mesylate, scientifically recognised as DX-8951f, is a hexacyclic chemical compound analogous to camptothecin, with essential antitumoral properties. Exatecan mesylate is used as an inhibitor of DNA topoisomerase I, that plays a key role in DNA replication, transcription, and recombination. Therefore, the use of exatecan mesylate is of great importance in prompting cell division and triggering cell death (Giles, 2000).</p>

<p>Antagonist of OX1 orexin receptor</p>

<p>EBV antibody (gp250/350) was raised in mouse using envelope glycoprotein complex 250/350 as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication. Extensive research has demonstrated its high frequency of human activity through patch-clamp technique analysis on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>SOX4 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 4 (Sox4)</p>

<p>Complement C1q antibody was raised in sheep using human C1q as the immunogen.</p>

<p>Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>NKX2-5 antibody was raised in Rabbit using Human NKX2-5 as the immunogen</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has demonstrated its high efficacy using advanced techniques such as the patch-clamp technique on human erythrocytes. In addition, this drug undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Pro-Collagen I antibody was raised in mouse using human procollagen I as the immunogen.</p>

<p>TGF alpha antibody was raised in mouse using 17-amino acid synthetic peptide from carboxyl-terminus of rat TGF-alpha as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AHSG antibody, catalog no. 70R-5916</p>

<p>Streptococcus Group B antibody was raised in mouse using Group B Streptococcus as the immunogen.</p>

<p>Rabbit polyclonal Ergocryptine antibody</p>

<p>Chikungunya virus antibody is a highly effective solution for combating the Chikungunya virus. This antibody specifically targets and neutralizes the virus, preventing its replication and spread within the body. It works by binding to collagen, which is present on the surface of infected cells, effectively blocking the virus from entering healthy cells.</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>The alpha Actin antibody is a monoclonal antibody that specifically targets and binds to alpha actin, a protein involved in muscle contraction. This antibody has various characteristics and applications in the field of Life Sciences. It can be used for research purposes to study the role of alpha actin in different biological processes. One of the key characteristics of this antibody is its cytotoxic activity. It has been shown to have a potent cytotoxic effect on human hepatocytes, inhibiting their growth and inducing cell death. This makes it a valuable tool for studying the mechanisms underlying liver diseases and potential therapeutic interventions. Additionally, the alpha Actin antibody has been found to have anti-vascular endothelial growth factor (anti-VEGF) properties. VEGF is a protein that promotes the formation of new blood vessels, and its overexpression is associated with various diseases, including cancer. By blocking VEGF activity, this antibody may help inhibit angiogenesis and tumor growth. Furthermore, this monoclonal antibody has</p>

<p>Insulin antibody is a monoclonal antibody that has inhibitory properties against insulin. It acts by binding to insulin and preventing its activation, thereby inhibiting its function in the body. This antibody has been shown to have inhibitory effects on various processes, including nuclear signaling pathways, chemokine production, interferon release, collagen synthesis, and the production of autoantibodies. Additionally, insulin antibody has been found to inhibit the activity of TGF-β1, a cytokine involved in cell growth and immune responses. In the field of Life Sciences, this antibody is commonly used in research studies involving insulin-related pathways and metabolism. It has also been utilized in liver microsome studies to investigate drug interactions and metabolic processes.</p>

<p>Phosphoserine antibody was raised in rabbit using phosphoserine-KLH and phosvitin mixture as the immunogen.</p>

<p>GARS antibody was raised in Rabbit using Human GARS as the immunogen</p>

<p>Region of M-CSF protein corresponding to amino acids MKEVSEHCSH MIGNGHLKVL QQLIDSQMET SCQIAFEFVD QEQLDDPVCY LKKAFFLVQD IIDETMRFKD NTPNANATER LQELSNNLNS CFTKDYEEQN KACVRTFHET PLQLLEKIKN FFNETKNLLE KDWNIFTKNC NNSFAKCSSR DVVTKP.</p>

<p>OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) (HRP) was raised in goat using rat IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>Purified recombinant Treponema pallidum TmpA protein</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.</p>

<p>Purified Recombinant Human Troponin I protein (Cardiac)</p>

<p>Region of FGF10 protein corresponding to amino acids MLGQDMVSPE ATNSSSSSFS SPSSAGRHVR SYNHLQGDVR WRKLFSFTKY FLKIEKNGKV SGTKKENCPY SILEITSVEI GVVAVKAINS NYYLAMNKKG KLYGSKEFNN DCKLKERIEE NGYNTYASFN WQHNGRQMYV ALNGKGAPRR GQKTRRKNTS AHFLPMVVHS.</p>

<p>CYP2C8 + CYP2C9 + CYP2C19 antibody was raised in rabbit using a synthetic peptide as the immunogen.</p>

<p>Purified recombinant Human ACADM protein</p>

<p>The Folic acid antibody is a highly specialized antibody that is used for various applications in the field of Life Sciences. It is commonly used in research and diagnostic laboratories for detecting and quantifying folic acid levels in biological samples.</p>

<p>Human Serum Albumin protein is a versatile protein widely used in the Life Sciences field. It serves as an enzyme substrate, making it valuable for various research applications. This protein has neutralizing properties and contains histidine residues that can be activated to bind to specific molecules. Human Serum Albumin also acts as an anticoagulant, preventing blood from clotting.</p>

<p>Human IgM antibody was raised in mouse using purified human serum IgM as the immunogen.</p>

<p>Dengue type 2 antibody was raised in mouse using dengue type 2, (New Guinea C), as the immunogen.</p>

<p>Quinidine antibody was raised in mouse using quinidine conjugated to KLH as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:</p>

<p>FKBP3 antibody was raised in mouse using recombinant Human Fk506 Binding Protein 3, 25Kda (Fkbp3)</p>

<p>The HCG antibody is a highly specialized product that offers a range of unique characteristics and applications in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize and inhibit the activity of human chorionic gonadotropin (HCG), a hormone that plays a crucial role in pregnancy.</p>

<p>Candida albicans antibody was raised in rabbit using Candida albicans, type A as the immunogen.</p>

<p>GSTA1 antibody was raised in Rabbit using Human GSTA1 as the immunogen</p>

<p>The cMyc antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and neutralizes the cMyc protein, which plays a crucial role in cell growth and proliferation. This antibody is commonly used in various applications such as immunoassays, protein kinase assays, and Western blotting to study the functions of cMyc and its involvement in different cellular processes.</p>

<p>The GAPDH protein is an antigen that is widely used in the field of Life Sciences. It has become a valuable tool for researchers due to its various applications. This protein can be used as an electrode in electrochemical experiments, allowing for the detection and quantification of specific molecules or compounds. Additionally, GAPDH can be targeted by antibodies, including monoclonal antibodies, which are commonly used in immunological studies. These antibodies can help identify and analyze the presence of GAPDH in different samples, such as human serum or tissue extracts. Furthermore, GAPDH plays important roles in cellular processes, including metabolism and energy production. It is involved in regulating glucose metabolism and has been shown to interact with molecules like glucagon, myostatin, and collagen. Overall, the versatile nature of GAPDH makes it a valuable asset for researchers in various fields of study within Life Sciences.</p>

<p>Purified native Human FABP protein (Cardiac)</p>

<p>CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.</p>

<p>V5 Tag antibody was raised in mouse using GKPIPNPLLGLDST (V5) synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant FAM49B protein (His tag)</p>

<p>Goat anti-cat IgG (H + L) (biotin) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>Rhodamine antibody was raised in Mouse using This protein A purified monoclonal antibody was produced after repeated immunizations of balb/c mice with rhodamine conjugated KLH. as the immunogen.</p>

<p>Purified recombinant EBV p138 protein (His tag)</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>IL8 antibody was raised in mouse using recombinant human IL8 as the immunogen.</p>

<p>Goat anti-monkey IgM (HRP) was raised in goat using monkey IgM as the immunogen.</p>

<p>Methadone antibody was raised in mouse using methadone-BSA as the immunogen.</p>

<p>The NMDAR1 antibody is a monoclonal antibody that specifically targets the N-methyl-D-aspartate receptor 1 (NMDAR1). This receptor plays a crucial role in synaptic plasticity and learning. The NMDAR1 antibody has been extensively studied and shown to have neutralizing properties against NMDAR1, preventing its activation by glutamate. This antibody has also been found to be effective in inhibiting the growth of Cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. Additionally, the NMDAR1 antibody has potential therapeutic applications in the treatment of conditions such as insulin resistance, as it can modulate insulin signaling pathways. It is also being investigated for its potential role in regulating natriuretic peptide levels and as a growth factor for certain cell types. With its ability to target specific receptors and modulate various biological processes, the NMDAR1 antibody holds great promise in both research and therapeutic applications.</p>

<p>Mouse monoclonal PSA antibody (HRP)</p>

<p>Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.</p>

<p>CYP1A1 antibody was raised in mouse using partially purified P450 1A1 induced rat liver microsomes as the immunogen.</p>

<p>sRANKL Human Recombinant protein containing 176 amino acids.</p>

<p>Conjugated Aflatoxin-BSA hapten</p>

<p>Goat anti-human IgA was raised in goat using purified human IgA as the immunogen.</p>

<p>Please enquire for more information about PSY1 Precursor Peptide with sulfated Tyrosine and triarabinosylated L-hydroxyproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LLPG including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PSY1 Precursor Peptide with triarabinosylated L-hydroxyproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Semaglutide is a peptide that is used as a pharmacological agent for the treatment of type 2 diabetes, and other diseases and is also used for long-term weight management in obesity. It is an analogue of glucagon-like peptide-1 (GLP-1) and acts as a GLP-1 receptor agonist and inhibitor of the enzyme DPP-4, which is responsible for the degradation of GLP-1. As a result, semaglutide increases levels of GLP-1, which stimulates insulin release from pancreatic beta cells. Semaglutide has been shown to reduce body weight, blood pressure and HbA1c levels in patients with type 2 diabetes, through its action to increase insulin production and inhibit the production of glucagon. Semaglutide acetate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>

<p>Dimenhydrinate is a drug that was initially used as an antihistamine to treat symptoms of allergies such as watery eyes, sneezing and a runny nose, however it is now used for the treatment and prevention of nausea, vertigo and motion sickness. Dimenhydrinate is a combination of diphenhydramine and 8-chlorotheophylline. Its antiemetic properties are thought to be produced from diphenhydramine’s antagonism of H1 histamine receptors. Also, it is believed to have antimuscarinic effects that minimize disturbances to the body’s equilibrium.</p>

<p>A peptide found in honey bee venom; Potassium channel inhibitor</p>

<p>Gliadin Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Gliadin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Gliadin Recombinant Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Gliadin Recombinant Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Diclazuril chemical reference substance</p>

<p>The HPV16 E7 antibody is a monoclonal antibody that specifically targets the human papillomavirus 16 (HPV16) E7 protein. This protein plays a crucial role in the development and progression of HPV-related cancers, making it an important target for therapeutic interventions.</p>

<p>Anti-FPV Antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 4)</p>

<p>Zika virus NS1 antibody is a mouse monoclonal antibody that recognizes the nonstructural protein 1 (NS1) of the Zika virus. NS1 is an immunodominant viral antigen associated with the humoral immune response to Zika virus. Antibodies targeting epitopes on the cell-surface form of NS1 have been shown to protect against Zika virus infection during pregnancy in mice. There is a high correlation between Zika virus NS1 antibodies and neutralizing antibodies in selected serum samples from normal healthy individuals. Mouse monoclonal antibodies against NS1 have the potential to be used as diagnostic tools for accurate diagnosis of Zika virus infection. Additionally, monoclonal antibodies against NS1 have the potential to suppress Zika virus pathogenicity without enhancement of the disease.</p>

<p>Actin antibody was raised in mouse using synthetic N- terminus decapeptide of alpha-smooth-muscle isoform of actin as the immunogen.</p>

<p>CD19 antibody was raised in mouse using human CD19 as the immunogen.</p>

<p>The Prealbumin antibody is a powerful tool used in the field of Life Sciences to detect and study various proteins. This antibody specifically targets the prealbumin protein, which is involved in various biological processes such as growth factor signaling. It is commonly used in research studies to investigate the role of prealbumin in different cellular pathways.</p>

<p>The FSH antibody is a monoclonal antibody that has the ability to specifically bind to follicle-stimulating hormone (FSH). This antibody can be used for various applications, including lysis of FSH-producing cells and ultrasensitive detection of FSH in immunoassays. The FSH antibody has been extensively characterized and shown to have high specificity and affinity for FSH. It can be used in different research areas within the Life Sciences field, such as studying the role of FSH in reproductive processes, investigating the effects of FSH on collagen and fibronectin production, or exploring its potential as a growth factor. Additionally, this monoclonal antibody may have neutralizing or cytotoxic effects on FSH-dependent processes. With its versatility and reliability, the FSH antibody is an essential tool for any researcher working with FSH-related studies.</p>

<p>KCNJ6 antibody was raised in Rabbit using Human KCNJ6 as the immunogen</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>Carbonic anhydrase II antibody was raised in rabbit using carbonic anhydrase II from bovine erythrocytes as the immunogen.</p>

<p>Mouse monoclonal Luteinizing Hormone beta antibody</p>

<p>Rabbit anti-chicken IgY (H + L) (Alk Phos) was raised in rabbit using chicken IgG (H &amp; L) as the immunogen.</p>

<p>GTF2H5 antibody was raised in Rabbit using Human GTF2H5 as the immunogen</p>

<p>Fibrillarin antibody was raised in mouse using yeast fibrillarin as the immunogen.</p>

<p>ART558 is a potent inhibitor of kinases, specifically targeting cyclin-dependent kinases (CDKs). It has been extensively studied for its potential use in cancer treatment. ART558 works by inhibiting the activity of CDKs, which are proteins that regulate cell division and growth. This inhibition leads to apoptosis, or programmed cell death, in cancer cells. ART558 has shown promising results in preclinical studies against a variety of human cancers, including lung and breast tumors. Additionally, it has been found to be effective against Chinese hamster ovary cells and other tumor cells. ART558 is being developed as an anticancer drug candidate due to its medicinal properties and potential as a targeted therapy for cancer patients.</p>