Carboxylic Acids

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>

<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>

<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Modafinil is a drug that belongs to the class of wakefulness-promoting agents. It has been shown to have a long half-life and low toxicity in humans, which may be due to its effects on cytochrome P450 isoenzymes. Modafinil has been studied in clinical trials for its tolerability, with no significant side effects reported. The drug has also been shown to have anticonvulsant properties and can be used as an adjunctive treatment for patients with partial seizures. Modafinil binds to the GABA receptor in the brain and increases GABAergic neurotransmission. The compound's mechanism of action is not fully understood, but it is believed that it acts by inhibiting cyclic AMP degradation and increasing cAMP levels in the brain. This increase in cAMP levels may lead to increased protein kinase activity, decreased phosphorylation of glutamate receptors, increased release of dopamine, and decreased release of histamine from mast cells.</p>

<p>5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>

<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>

<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>

<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>Please enquire for more information about Mca-Pro-b-cyclohexyl-Ala-Gly-Nva-His-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>

<p>Parathyroid hormone (PTH) is a peptide hormone that regulates calcium and phosphate balance in the body. PTH is secreted by the parathyroid glands, located near the thyroid gland in the neck. It is also known as parathormone or parathyrin. The active form of PTH, called pTH (1-34) amide, has been shown to stimulate bone resorption and to inhibit bone formation. The amino acid sequence of this hormone starts with arginine and ends with phenylalanine. The N-terminal amino acid residue is an aspartic acid or asparagine and histidine is the only basic residue in this molecule. This molecule has two acidic residues, glutamic acid and aspartic acid, which are found on the side chains of two amino acids: aspartic acid and glutamic acid. Valine is found at position 3 and phenylalanine at position 34.</p>

<p>Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>

<p>Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>

<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>

<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>

<p>2-Mercaptonicotinic acid (2MNA) is an inhibitor of the P-glycoprotein, which is a multidrug resistance-associated protein. It prevents the transport of drugs and other molecules across the cell membrane. 2MNA has been shown to inhibit cancer cells in cervical cancer studies, and has been proven to reduce the toxicity of chemotherapy drugs in rats. 2MNA binds to p-glycoprotein and inhibits its function by forming a disulfide bond with cysteine residues on the transporter. 2MNA also has toxic effects on human serum and may be hazardous for use as a therapeutic agent.</p>

<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The trifluorophenylboronic acid is a boronic acid that has been used in the synthesis of vitamin B12. This compound is often used as a catalyst for the Suzuki coupling reaction. It can also be used to synthesize amides and synthons. The trifluorophenylboronic acid is soluble in water, ethanol, and acetone. The pH of the solution depends on the type of base added. For example, when an amine is added to the solution, it increases to approximately 8-9. When a p-hydroxybenzoic acid is added to the solution, it decreases to approximately 2-3.</p>

<p>Hydrazine acetate is an organic solution that has a glycoconjugate. It is also found in uridine, hydrogen bond and serine protease. Hydrazine acetate has been shown to have a benzyl group and carbonyl group. Hydrazine acetate interacts with trifluoroacetic acid and particle. This drug can be used for the treatment of autoimmune diseases, such as rheumatoid arthritis, and infectious diseases such as HIV/AIDS. Hydrazine acetate has shown high values for growth factor activity, which may be due to its ability to inhibit the enzyme ns3 protease in the synthesis of proinflammatory cytokines.</p>

<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>

<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>

<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>

<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>

<p>2-Chlorooxazole-4-carboxylic acid is a synthetic compound belonging to the group of long-chain aliphatic carboxylic acids. It is an ester that can be synthesized by the reaction of toluene with 2,4-dichlorooxazole. The stereochemical configuration of this molecule is unknown. The synthesis of this compound has been reported in marine invertebrates and plants, including Mycalolide from the marine sponge Mycale sp.</p>

<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pamoic acid is a disodium salt of p-aminobenzoic acid. It is an excipient that is considered safe for use in food and pharmaceuticals. Pamoic acid has been used as a preservative and an antioxidant. It prevents the oxidation of fats, oils, and other lipids by reacting with them to form stable compounds. The most common use of pamoic acid is as an anti-spasmodic drug to manage colitis, although it also has been used to treat seizures and spasticity in people with nervous system diseases. Pamoic acid can be used in combination with benzalkonium chloride as a preservative for injectable drugs such as antibiotics or chemotherapy agents. When combined with benzalkonium chloride, pamoic acid acts as a sweetener and particle size modifier.</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>

<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>

<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>

<p>Intermediate in the synthesis of afatinib</p>