
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molOrotic acid anhydrous
CAS:<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>Formula:C5H4N2O4Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:156.1 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/molHepcidin-1 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H169N31O35S8Purity:Min. 95%Molecular weight:2,754.25 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H43N5O8Purity:Min. 95%Molecular weight:637.72 g/mol(Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H108N22O12Purity:Min. 95%Molecular weight:1,401.7 g/molC5a Anaphylatoxin (37-53) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (37-53) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H141N27O22SPurity:Min. 95%Molecular weight:1,889.23 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molPrepro-Neuromedin S (70-103) (human) trifluoroacetate salt
<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H271N49O44SPurity:Min. 95%Molecular weight:3,857.45 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/molMyelin Proteolipid Protein (139-151) (depalmitoylated) (human, bovine, dog, mouse, rat) trifluoroacetate salt
CAS:<p>MPLP(139-151) is a peptide that is derived from the myelin proteolipid protein (PLP). MPLP(139-151) has been shown to inhibit macrophage inflammatory in vitro and brain inflammation in vivo. The inhibition of macrophages was mediated by the induction of apoptosis and inhibition of NF-κB. MPLP(139-151) also induced regression of experimental autoimmune encephalomyelitis in mice, which suggests that it might be useful as a therapeutic agent for multiple sclerosis or other inflammatory diseases.</p>Formula:C72H104N20O16SPurity:Min. 95%Molecular weight:1,537.79 g/molKemptamide trifluoroacetate salt
CAS:<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>Formula:C65H112N24O18Purity:Min. 95%Molecular weight:1,517.74 g/molN-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid
CAS:<p>N-(tert-Butyloxycarbonyl)-8-amino-3,6-dioxaoctanoic acid is a potential drug for hypercholesterolemia. It has been shown to lower LDL cholesterol and triglycerides levels in monkeys. The compound is orally bioavailable and can be taken orally. This drug also has the potential to be developed as a PCSK9 (proprotein convertase subtilisin/kexin type 9) inhibitor.</p>Formula:C11H21NO6Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:263.29 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/mol(2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid
CAS:<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H8FNO2Purity:Min. 95%Molecular weight:133.12 g/molNeuropeptide W-30 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O38SPurity:Min. 95%Molecular weight:3,559.12 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H361N57O80S2Purity:Min. 95%Molecular weight:5,472.98 g/molRVG-9R trifluoroacetate salt
CAS:<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C201H334N82O55S2Purity:Min. 95%Molecular weight:4,843.45 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/molNeuropeptide Y (3-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H271N53O54Purity:Min. 95%Molecular weight:3,993.36 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H258N52O44S5Purity:Min. 95%Molecular weight:3,690.34 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/molPalmitoleic acid methyl ester
CAS:<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>Formula:C17H32O2Purity:Min. 95%Molecular weight:268.43 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/mol(Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C133H205N39O29SPurity:Min. 95%Molecular weight:2,846.36 g/molDiphenolic acid
CAS:<p>Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol.<br>Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.</p>Formula:C17H18O4Color and Shape:White PowderMolecular weight:286.32 g/molH-Arg-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>Formula:C18H38N12O4Purity:Min. 95%Molecular weight:486.57 g/molPep-1-cysteamide trifluoroacetate salt
CAS:<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H202N36O33SPurity:Min. 95%Molecular weight:2,949.39 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molBradykinin (1-7) acetate salt
CAS:<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>Formula:C35H52N10O9Purity:Min. 95%Molecular weight:756.85 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/molCART (61-102) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H310N58O56S7Purity:Min. 95%Molecular weight:4,515.3 g/molα-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS:<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>Formula:C29H51N11O11Purity:Min. 95%Molecular weight:729.78 g/molSperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/molα-Conotoxin MI trifluoroacetate salt
CAS:Controlled Product<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>Formula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/molRANTES (human) trifluoroacetate salt
<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C350H534N96O100S5Purity:Min. 95%Molecular weight:7,846.9 g/molPAR-2 (1-6) (human) trifluoroacetate salt
CAS:<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molDynorphin A trifluoroacetate salt
CAS:<p>Dynorphin A is a peptide that belongs to the class of opioid peptides. It acts as a kappa-opioid receptor agonist and is involved in the transmission of pain signals and other information from the central nervous system to the peripheral nervous system. Dynorphin A has been shown to inhibit the release of neurotransmitters, such as acetylcholine, dopamine, serotonin, and norepinephrine. It also blocks the action of transmitters at postsynaptic membranes by binding to their receptors. Dynorphin A binds with high affinity to kappa-opioid receptors and can be used for treatment of heroin addiction and chronic pain.</p>Formula:C99H155N31O23Purity:Min. 95%Molecular weight:2,147.49 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H98N18O20SPurity:Min. 95%Molecular weight:1,447.62 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/molAPL1b27 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C103H174N30O38SPurity:Min. 95%Molecular weight:2,472.73 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N7O6·C2H4O2Purity:Min. 95%Molecular weight:677.75 g/molEglin c (60-63)-methyl ester acetate salt
CAS:<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>Formula:C19H35N5O7Purity:Min. 95%Molecular weight:445.51 g/mol2,4,5-Trifluorobenzoic acid
CAS:<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>Formula:C7H3F3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.09 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/molH-Arg-Ser-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Ser-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N5O4Purity:Min. 95%Molecular weight:261.28 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N54O56SPurity:Min. 95%Molecular weight:4,328.86 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H116N20O19SPurity:Min. 95%Molecular weight:1,657.93 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C214H324N58O63SPurity:Min. 95%Molecular weight:4,749.28 g/mol([ring-D5]Phe3)-Octreotide acetate salt
CAS:Controlled Product<p>Please enquire for more information about ([ring-D5]Phe3)-Octreotide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H61D5N10O10S2Purity:Min. 95%Molecular weight:1,024.27 g/mol(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H94N22O21Purity:Min. 95%Molecular weight:1,423.49 g/molFmoc-L-Lys[Oct-(otBu)-Glu-(otBu)-AEEA-AEEA]-OH
CAS:<p>Please enquire for more information about Fmoc-L-Lys[Oct-(otBu)-Glu-(otBu)-AEEA-AEEA]-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H101N5O16Purity:Min. 95%Molecular weight:1,196.51 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Formula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/molH-Ala-Gly-Tyr-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molH-Glu-Gly-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N8O7Purity:Min. 95%Molecular weight:480.48 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Formula:C39H63N11O10Purity:Min. 95%Molecular weight:845.99 g/molApelin-36 (1-16) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Apelin-36 (1-16) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H117N27O20Purity:Min. 95%Molecular weight:1,704.89 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formula:C84H119N27O28Purity:Min. 95%Molecular weight:1,955.01 g/mol3-[(2-Aminoethyl)dithio]propionic acid
CAS:<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>Formula:C5H11NO2S2Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:181.28 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molDimercaptosuccinic acid
CAS:<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>Formula:C4H6O4S2Color and Shape:White PowderMolecular weight:182.22 g/mol4-tert-Butylphenylboronic acid
CAS:<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/mol4-Acetyl-piperidine-1-carboxylic acid tert-butyl ester
CAS:<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>Formula:C12H21NO3Purity:Min. 95%Molecular weight:227.3 g/mol12-Doxyl stearic acid
CAS:<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>Formula:C22H42NO4Purity:Min. 95%Color and Shape:Yellow Clear LiquidMolecular weight:384.57 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/mol6-Bromohexanoic acid methyl ester
CAS:<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>Formula:C7H13BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:209.08 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/molBiotinyl-Obestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H190N34O35SPurity:Min. 95%Molecular weight:2,773.13 g/moltert-Butyl cis-4-hydroxycyclohexylcarbamate
CAS:<p>Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.</p>Formula:C11H21NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:215.29 g/molAlloferon 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H69N19O15Purity:Min. 95%Molecular weight:1,128.16 g/molCART (55-76) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (55-76) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H166N26O33S3Purity:Min. 95%Molecular weight:2,440.82 g/mol(3,4,5-Trifluorophenyl)boronic acid
CAS:<p>The trifluorophenylboronic acid is a boronic acid that has been used in the synthesis of vitamin B12. This compound is often used as a catalyst for the Suzuki coupling reaction. It can also be used to synthesize amides and synthons. The trifluorophenylboronic acid is soluble in water, ethanol, and acetone. The pH of the solution depends on the type of base added. For example, when an amine is added to the solution, it increases to approximately 8-9. When a p-hydroxybenzoic acid is added to the solution, it decreases to approximately 2-3.</p>Formula:C6H4BF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:175.9 g/mol2,5-Diaminoterephthalic acid
CAS:<p>2,5-Diaminoterephthalic acid is a synthetic organic compound that is used as a building block for the synthesis of polyamides. It has been shown to have high salt adsorption properties and low detection limits for certain analytes. 2,5-Diaminoterephthalic acid has also been found to have photocatalytic activity and can be used in the treatment of cancer. This chemical reacts with nitro groups on nucleophilic attack to form the carcinogenic nitrosamine. The formation rate of this nitrosamine depends on the presence of methoxy groups and nitrogen atoms in 2,5-diaminoterephthalic acid.</p>Formula:C8H8N2O4Purity:Min. 95%Molecular weight:196.16 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/molAnxiety Peptide acetate salt
CAS:<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>Formula:C81H138N24O29Purity:Min. 95%Molecular weight:1,912.11 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/mol3-Acetylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 3-Acetylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19BO3Purity:Min. 95%Molecular weight:246.11 g/mol(Des-Gly2)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly2)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H279N49O59SPurity:Min. 95%Molecular weight:4,129.52 g/molAcetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt
CAS:<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>Formula:C22H40N6O8Purity:Min. 95%Molecular weight:516.59 g/molC5a Anaphylatoxin (human) trifluoroacetate salt )
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C350H578N108O107S8Purity:Min. 95%Molecular weight:8,267.53 g/mol(Lys7)-Dermorphin acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Lys7)-Dermorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H57N9O9Purity:Min. 95%Molecular weight:843.97 g/molSodium fluoroacetate
CAS:<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>Formula:C2H2FNaO2Color and Shape:White PowderMolecular weight:100.02 g/mol(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H240N44O38Purity:Min. 95%Molecular weight:3,171.7 g/molGanoderic acid G
CAS:Controlled Product<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>Formula:C30H44O8Purity:Min. 95%Color and Shape:SolidMolecular weight:532.67 g/molAbz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H71N11O18Purity:Min. 95%Molecular weight:1,258.29 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS:<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formula:C50H73N13O11Purity:Min. 95%Molecular weight:1,032.2 g/molCorticostatin I (rabbit) trifluoroacetate salt
CAS:<p>Please enquire for more information about Corticostatin I (rabbit) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C163H259N63O44S6Purity:Min. 95%Molecular weight:3,997.59 g/molMca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H82N16O18Purity:Min. 95%Molecular weight:1,327.4 g/mol(D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C158H265N49O43Purity:Min. 95%Molecular weight:3,539.1 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS:<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formula:C26H42N8O8Purity:Min. 95%Molecular weight:594.66 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H105N17O12SPurity:Min. 95%Molecular weight:1,384.73 g/molcis-4-Aminocyclohexanecarboxylic acid methyl ester hcl
CAS:<p>cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl is a chemical compound that is used in research and industry. It is an efficient isomer of 4-aminocyclohexanecarboxylic acid methyl ester hydrochloride. cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl has been used as a model for the study of glimepiride, an insulin secretagogue, and has been shown to be active against Toxoplasma gondii.</p>Formula:C8H15NO2·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:193.67 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/moltert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Endothelin-2 (human, canine) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/molH-Pro-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O5Purity:Min. 95%Molecular weight:447.53 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molFmoc-L-aspartic acid β-methylpentyl ester
CAS:<p>Fmoc-L-aspartic acid b-methylpentyl ester is a solid phase synthesis of Asp(OtBu)-OH that has been synthesized by reacting aspartic acid with piperidine and methylbenzene. This synthesis has been shown to be effective at temperatures below 25°C, to minimize the formation of water, and to be resistant to treatments with strong acids or bases. The synthesis has also been optimized for the peptidyl bond formation and peptide synthesis, resulting in enhanced yields.</p>Formula:C25H29NO6Purity:Min. 95%Color and Shape:White PowderMolecular weight:439.5 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H64N14O12SPurity:Min. 95%Molecular weight:965.09 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molH-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H58N12O9Purity:Min. 95%Molecular weight:850.96 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS:<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H4BF4NO2Purity:Min. 95%Molecular weight:208.91 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molL-Lysine acetate
CAS:Controlled Product<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>Formula:C8H18N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.24 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurity:Min. 95%Molecular weight:1,510.23 g/molMethyl diethylphosphonoacetate
CAS:<p>Methyl diethylphosphonoacetate is a chemical compound that contains a hydroxy group, an alkynyl group and a disulfide bond. It is used as a control agent in the production of polyurethane foams, and has also been shown to inhibit the growth of bladder cancer cells. The UV absorption peak at 220 nm can be used to identify this chemical compound. Methyl diethylphosphonoacetate reacts with proton to form diethylphosphonoacetate, which then undergoes an elimination reaction with fatty acids to form aliphatic hydrocarbons. This reaction mechanism was first proposed by Stork and co-workers in 1960. Methyl diethylphosphonoacetate also binds to thrombin receptor, which may lead to anti-inflammatory effects.</p>Formula:C7H15O5PPurity:Min. 95%Molecular weight:210.16 g/mol(Tyr9)-β-MSH (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H140N24O30SPurity:Min. 95%Molecular weight:2,202.4 g/molNeuropeptide Y (22-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H139N29O21Purity:Min. 95%Molecular weight:1,903.2 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/molSerpinin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H202N32O46Purity:Min. 95%Molecular weight:2,865.11 g/mol2-Bromo-4,5-dimethoxybenzoic acid
CAS:<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>Formula:C9H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:261.07 g/molMethyl 4-tert-butylphenylacetate
CAS:<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>Formula:C13H18O2Purity:Min. 95%Molecular weight:206.28 g/mol(Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H293N53O58SPurity:Min. 95%Molecular weight:4,315.78 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/molGRF (1-29) amide (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molPAR-2 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H55N9O8Purity:Min. 95%Molecular weight:657.8 g/molMethyl 2,2-difluoro-2-(fluorosulfonyl)acetate
CAS:<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>Formula:C3H3F3O4SPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:192.11 g/molKR-12 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molβ-Casomorphin (1-3) amide acetate salt
CAS:<p>Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.</p>Formula:C23H28N4O4Purity:Min. 95%Molecular weight:424.49 g/molGambogic acid
CAS:<p>Gambogic acid is a xanthonoid compound, which is a naturally occurring product derived from the resin of Garcinia hanburyi, a tree found in Southeast Asia. It functions primarily through its apoptotic and anti-proliferative effects on cancer cells. Mechanistically, Gambogic acid binds to transferrin receptors, leading to the disruption of cell survival pathways, inhibition of the NF-kB signaling pathway, and induction of apoptosis by activating caspases and influencing mitochondrial pathways.</p>Purity:Min. 95%H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Formula:C40H58N10O7SPurity:Min. 95%Molecular weight:823.02 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C146H234N46O52Purity:Min. 95%Molecular weight:3,465.7 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37Purity:Min. 95%Molecular weight:2,763.07 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H281N57O54S2Purity:Min. 95%Molecular weight:4,207.67 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/molBz-Ile-Glu-Gly-Arg-pNA acetate salt
CAS:<p>Bz-Ile-Glu-Gly-Arg-pNA acetate salt is an anticoagulant that binds to heparin. It has been shown to inhibit protease activity in soybean trypsin by binding to the active site of the enzyme. Bz-Ile-Glu-Gly-Arg-pNA acetate salt has also been shown to have a molecular weight of heparin and a protein synthesis inhibition rate of fibrinogen, which is responsible for coagulation.</p>Formula:C32H43N9O9Purity:Min. 95%Molecular weight:697.74 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS:<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H15BrO4S•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:329.21 g/molNeuronostatin-13 (human, canine, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H110N20O16Purity:Min. 95%Molecular weight:1,415.68 g/molUndecanoic acid
CAS:<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>Formula:C11H22O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.29 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/mol2,4-Dinitrophenylacetic acid
CAS:<p>2,4-Dinitrophenylacetic acid is a chemical substance with the potential to inhibit acetylation. It can be used as an antigen and has been detected in environmental chemistry. 2,4-Dinitrophenylacetic acid is produced by the reaction of chemicals that are found in the environment and it can be detected at low concentrations. This compound is able to react with proteins in cells, leading to high cytotoxicity. 2,4-Dinitrophenylacetic acid can also stabilize optical systems.</p>Formula:C8H6N2O6Purity:Min. 95%Color and Shape:PowderMolecular weight:226.14 g/mol(D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt
CAS:<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>Formula:C29H41N5O7SPurity:Min. 95%Molecular weight:603.73 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H276N54O55SPurity:Min. 95%Molecular weight:4,108.51 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/mol(D-Lys6)-LHRH (free acid) acetate salt
CAS:Controlled Product<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H83N17O14Purity:Min. 95%Molecular weight:1,254.4 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H73N13O26Purity:Min. 95%Molecular weight:1,344.25 g/molAmyloid β-Protein (40-1) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molAPL1b25 trifluoroacetate salt
CAS:<p>Please enquire for more information about APL1b25 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H166N28O35SPurity:Min. 95%Molecular weight:2,328.6 g/mol2-Hydroxy nicotinic acid
CAS:<p>2-Hydroxy nicotinic acid is a carboxylate with a hydroxyl group. The compound has been shown to produce light emission in the presence of ultraviolet radiation and picolinic acid, which is an electron acceptor. This reaction is catalyzed by NADH oxidase and requires the presence of molecular oxygen. 2-Hydroxy nicotinic acid has also been shown to inhibit the activity of enzymes that are involved in the synthesis of nicotinamide adenine dinucleotide (NAD), including nicotinamide phosphoribosyltransferase (NAMPT), which produces NAD from niacinamide, and nicotinate phosphoribosyltransferase (NPT). The optimum concentration for this compound is between 1-2 mM. 2-Hydroxy nicotinic acid can be synthesized from natural compounds such as vitamin B3 or nicotinamide riboside through hydrolysis.</p>Formula:C6H5NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:139.11 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molObestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N32O33Purity:Min. 95%Molecular weight:2,546.83 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H273N51O57Purity:Min. 95%Molecular weight:4,111.45 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/molMethyl benzofuran-6-carboxylate
CAS:<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>Formula:C10H8O3Purity:Min. 95%Molecular weight:176.17 g/molHydrazine acetate
CAS:Controlled Product<p>Hydrazine acetate is an organic solution that has a glycoconjugate. It is also found in uridine, hydrogen bond and serine protease. Hydrazine acetate has been shown to have a benzyl group and carbonyl group. Hydrazine acetate interacts with trifluoroacetic acid and particle. This drug can be used for the treatment of autoimmune diseases, such as rheumatoid arthritis, and infectious diseases such as HIV/AIDS. Hydrazine acetate has shown high values for growth factor activity, which may be due to its ability to inhibit the enzyme ns3 protease in the synthesis of proinflammatory cytokines.</p>Formula:C2H4O2·H4N2Purity:Min. 95%Color and Shape:White PowderMolecular weight:92.1 g/molPyromeconic acid
CAS:<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>Formula:C5H4O3Purity:Min. 95%Color and Shape:Off-White To Light (Or Pale) Yellow SolidMolecular weight:112.08 g/mol4-Methoxy-3-(trifluoromethyl)benzoic acid
CAS:<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>Formula:C9H7F3O3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:220.15 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS:<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>Formula:C35H57N13O14S2Purity:Min. 95%Molecular weight:948.04 g/molOrotic acid hydrate
CAS:<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>Formula:C5H4N2O4·H2OPurity:Min. 95 Area-%Color and Shape:PowderMolecular weight:174.11 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H115N25O17Purity:Min. 95%Molecular weight:1,734.96 g/molH-Arg-His-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N8O2Purity:Min. 95%Molecular weight:310.36 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.</p>Formula:C42H86N28O8Purity:Min. 95%Molecular weight:1,111.32 g/mol2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS:<p>2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.</p>Formula:C9H6BrNO5Purity:Min. 95%Molecular weight:288.05 g/molOsteogenic Growth Peptide (10-14) trifluoroacetate salt
CAS:<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/mol(Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C226H338N60O64SPurity:Min. 95%Molecular weight:4,951.53 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H84N20O13Purity:Min. 95%Molecular weight:1,329.47 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21BO3Purity:Min. 95%Molecular weight:248.13 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS:<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>Formula:C9H8BrClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:263.52 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/molAc-D-Ala-D-lactic acid
CAS:<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/mol(d(CH2)51,Tyr(Me)2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>The monoclonal antibody (mAb) is a recombinant protein that binds to the extracellular region of the vasopressin receptor. It is used in pharmacological research to study the physiological function and pharmacological effects of vasopressin. The mAb has been shown to be minimally toxic, with an LD50 value of greater than 10 mg/kg in mice. It has also been shown to inhibit viruses and inhibit drug-sensitive enzymes. This antibody can be used as a diagnostic tool for congestive heart disease, as well as in experimental models for studying the minimal toxicity and tumor treatment properties of various drugs.</p>Formula:C52H74N14O12S2Purity:Min. 95%Molecular weight:1,151.36 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/mol(D-Trp11)-Neurotensin acetate salt
CAS:<p>Acetate salt</p>Formula:C80H122N22O19Purity:Min. 95%Molecular weight:1,695.96 g/molNeuromedin S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H307N57O49SPurity:Min. 95%Molecular weight:4,241.92 g/mol5-Methylpyrimidine-2-carboxylic acid
CAS:<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O2Purity:Min. 95%Molecular weight:138.12 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H84N18O8Purity:Min. 95%Molecular weight:1,029.29 g/molpTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C207H334N66O58Purity:Min. 95%Molecular weight:4,675.28 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS:<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>Formula:C23H34N6O6Purity:Min. 95%Molecular weight:490.55 g/molAdrenomedullin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C242H381N77O75S5Purity:Min. 95%Molecular weight:5,729.42 g/molCys-CD36 (139-155) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-CD36 (139-155) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H133N25O26SPurity:Min. 95%Molecular weight:1,977.21 g/mol
