
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Sodium fluoroacetate
CAS:<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>Formula:C2H2FNaO2Color and Shape:White PowderMolecular weight:100.02 g/mol(Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt
CAS:<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H75N13O9Purity:Min. 95%Molecular weight:918.14 g/molD-Isoascorbic acid
CAS:<p>D-Isoascorbic acid is a sodium salt of ascorbic acid. It is used for the prevention and treatment of scurvy, which is caused by vitamin C deficiency. D-Isoascorbic acid functions as an electron donor in biochemical reactions and has been shown to have physiological effects. Ascorbic acid (vitamin C) is a water-soluble antioxidant that can react with hydrogen fluoride in vitro to form free radicals that may cause damage to cells. In addition, D-Isoascorbic acid can be used as a model system for the study of ascorbic acid and p-hydroxybenzoic acid. The analytical method for determining these compounds involves electrochemical impedance spectroscopy.</p>Formula:C6H8O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:170 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/mol4-Fluoro-2-(trifluoromethyl)phenylboronic acid
CAS:<p>The process development of 4-fluoro-2-(trifluoromethyl)phenylboronic acid (4FTFPBA) is a simplified procedure that can be scaled up and used for medicinal chemistry. This compound was synthesized by a boronic acid process using the Suzuki-Miyaura cross coupling reaction. The major factor to consider in this synthesis is the placement of the fluorine atom, which determines the relative reactivity and stability of the compound. In order to mimic these factors, an environment with low water content and a sequence that minimizes exposure to air are required.</p>Formula:C7H5BF4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:207.92 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molH-His-His-OH trifluoroacetate salt
CAS:<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>Formula:C12H16N6O3Purity:Min. 95%Molecular weight:292.29 g/molNeuropeptide EI (human, mouse, rat) trifluoroacetate salt
CAS:<p>Neuropeptide EI is a cyclic peptide that has been shown to have receptor activity in the caudate putamen, as well as locomotor activity and metabolic rate. Neuropeptide EI has also been shown to inhibit lymphatic vessels and amide sequences in fat cells. It has been shown to have various biological functions, such as an anti-inflammatory agent, an analgesic, and a chemotherapeutic agent. It is active against cancer cells and autoimmune diseases, but is inactive against bacteria.</p>Formula:C63H98N16O23Purity:Min. 95%Molecular weight:1,447.55 g/molQuinoline-4-carboxylic acid
CAS:<p>Quinoline-4-carboxylic acid is a natural compound that is derived from the amino acid tryptophan. It has been shown to have antiinflammatory activity and to be an inhibitor of prostaglandin synthesis. Quinoline-4-carboxylic acid inhibits the growth of carcinoma cells in culture by inducing apoptosis, which is mediated by inhibition of protein synthesis. Quinoline-4-carboxylic acid also has pharmacokinetic properties, including a low volume of distribution, low clearance rate and high bioavailability.</p>Formula:C10H7NO2Purity:Min. 97 Area-%Molecular weight:173.17 g/molO-Hippuryl-L-b-phenyllactic acid sodium salt
CAS:<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/mol1-(Mercaptomethyl)cyclopropaneacetic acid
CAS:<p>1-(Mercaptomethyl)cyclopropaneacetic acid is a reaction product of hydrolysis, transfer, and industrialization. It is used in the synthesis of organic compounds such as quinolinediols and thioureas. 1-(Mercaptomethyl)cyclopropaneacetic acid is typically prepared by the reaction of an alkylsulfonyl chloride with an inorganic base such as lithium or sodium carbonate in an organic solvent such as acetonitrile. The compound is also used to produce other organosulfur compounds, including imino sulfides and disulfides.</p>Formula:C6H10O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:146.21 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/mol3-Amino-4-hydroxybenzoic acid hydrochloride
CAS:<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>Formula:C7H8ClNO3Purity:Min. 95%Molecular weight:189.6 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H159N25O32S5·C2HF3O2Purity:Min. 95%Molecular weight:2,605.93 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H244N40O42SPurity:Min. 95%Molecular weight:3,335.87 g/molH-Gly-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15N3O2·C2H4O2Purity:Min. 95%Molecular weight:281.31 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H79N17O13Purity:Min. 95%Molecular weight:1,138.28 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/mol2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid
CAS:<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BF2O4Purity:Min. 95%Molecular weight:201.92 g/mol4-Hydroxyphenylboronic acid
CAS:<p>4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.</p>Formula:C6H7BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:137.93 g/molGAP 27 acetate salt
CAS:<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>Formula:C60H101N15O17Purity:Min. 95%Molecular weight:1,304.53 g/molLinoleic acid - powder
CAS:<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>Formula:C18H32O2Purity:Min. 95%Color and Shape:PowderMolecular weight:280.45 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/mol2,6-Dichloro-5-fluoronicotinic acid
CAS:<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>Formula:C6H2Cl2FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:209.99 g/molH-Lys-Tyr-OH acetate salt
CAS:<p>H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.</p>Formula:C15H23N3O4Purity:Min. 95%Molecular weight:309.36 g/molZ-Gly-Pro-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N8O7·C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:642.66 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt
CAS:<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C79H119N15O13Purity:Min. 95%Molecular weight:1,486.88 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formula:C66H93N19O25Purity:Min. 95%Molecular weight:1,552.56 g/molcis-4-Aminocyclohexanecarboxylic acid methyl ester hcl
CAS:<p>cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl is a chemical compound that is used in research and industry. It is an efficient isomer of 4-aminocyclohexanecarboxylic acid methyl ester hydrochloride. cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl has been used as a model for the study of glimepiride, an insulin secretagogue, and has been shown to be active against Toxoplasma gondii.</p>Formula:C8H15NO2·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:193.67 g/mol5-Nitro nicotinic acid
CAS:<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formula:C6H4N2O4Purity:Min. 95%Molecular weight:168.11 g/molH-D-Arg(Me)-OH acetate salt
CAS:Controlled Product<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Formula:C7H16N4O2Purity:Min. 95%Molecular weight:188.23 g/molAmyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-42) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O60SPurity:Min. 95%Molecular weight:4,514.04 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C44H68N10O18S2Purity:Min. 95%Molecular weight:1,089.2 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H258N52O44S5Purity:Min. 95%Molecular weight:3,690.34 g/molBoc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond)
CAS:<p>Please enquire for more information about Boc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H50N8O12S2Purity:Min. 95%Molecular weight:874.98 g/molAnnexin A1 (1-11) (dephosphorylated) (human, bovine, chicken, porcine) trifluoroacetate salt
CAS:<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>Formula:C63H94N14O17SPurity:Min. 95%Molecular weight:1,351.57 g/molAmyloid β-Protein (1-15) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (1-15) is a peptide fragment of the amyloid protein that is associated with Alzheimer's disease. Amyloid beta-Protein (1-15) activates the transcription of a number of genes, including those that encode neurotrophic factors and growth factors. It has been shown to have neurotrophic properties and to increase the survival rate of neurons in vitro. It also protects against neuronal death induced by oxidative stress and high concentrations of glutamate. The structure of amyloid beta-protein (1-15) has been elucidated using molecular modeling techniques and X-ray crystallography. The trifluoroacetate salt form is stable at physiological pH levels and shows good solubility in water, making it an attractive therapeutic drug candidate.</p>Formula:C78H107N25O27Purity:Min. 95%Molecular weight:1,826.84 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H268N48O51S2Purity:Min. 95%Molecular weight:4,044.53 g/molN-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O37SPurity:Min. 95%Molecular weight:3,543.12 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/mol5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid
CAS:<p>5-Formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid is a chemical compound that is used in the formylation of amines to produce formamides. It has been optimized for industrial production by optimizing reaction time, formylation conditions, and solvents. It has also been shown that 5-formyl-2,4-dimethyl-1H-pyrrole-3-carboxylic acid produces good yields and high product purity.</p>Formula:C8H9NO3Purity:Min. 95%Molecular weight:167.16 g/molHel 13-5 trifluoroacetate salt
CAS:Controlled Product<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formula:C113H204N24O19Purity:Min. 95%Molecular weight:2,202.98 g/molOsteocalcin (1-49) (human) acetate salt
CAS:<p>Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.</p>Formula:C269H381N67O82S2Purity:Min. 95%Molecular weight:5,929.44 g/molBoc-trans-4-aminocyclohexane acetic acid
CAS:<p>Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H23NO4Molecular weight:257.33 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H11BO4Purity:Min. 95%Molecular weight:193.99 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formula:C6H6F2N2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:176.12 g/mol(Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C137H212N40O30Purity:Min. 95%Molecular weight:2,899.4 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H278N54O55Purity:Min. 95%Molecular weight:4,090.47 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H106N22O12Purity:Min. 95%Molecular weight:1,375.67 g/mol(His(3-Me)2)-TRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H24N6O4Purity:Min. 95%Molecular weight:376.41 g/molDSP
CAS:<p>DSP is a widely used disulfide crosslinker in ADC synthesis. It forms reversible conjugates via intracellular reduction, enabling payload release.</p>Formula:C14H16N2O8S2Purity:Min. 95%Color and Shape:SolidMolecular weight:404.42 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/mol4-Hydroxy-1,3-benzenedisulfonic acid
CAS:<p>4-Hydroxy-1,3-benzenedisulfonic acid (4HBDS) is a reactive molecule that is used as a model system for the study of chain reactions. 4HBDS does not undergo hydrolysis or oxidation and is stable in water. It can be prepared by the reaction of nitrate with acetate extract and has been shown to react with diazonium salts to form an analytical method for nitrite ion. 4HBDS reacts with hydrochloric acid to generate proton and significant interactions are observed at pH values between 1 and 3.</p>Purity:Min. 95%H-Lys-Pro-Tyr-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molp-Sulfophenylazochromotropic acid trisodium salt
CAS:<p>p-Sulfophenylazochromotropic acid trisodium salt is a chemical that can be used as a building block for the synthesis of various organic compounds. It is an intermediate for the synthesis of other chemicals and can be used as a research chemical in laboratories. This compound has been shown to be useful in the production of pharmaceuticals, agrochemicals, and dyes. CAS No. 23647-14-5.</p>Formula:C16H9N2Na3O11S3Purity:Min. 95 Area-%Color and Shape:Yellow PowderMolecular weight:570.42 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/mol[4-(1-Cyano-1-methylethyl)phenyl]boronic acid
CAS:<p>Please enquire for more information about [4-(1-Cyano-1-methylethyl)phenyl]boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H12BNO2Purity:Min. 95%Molecular weight:189.02 g/mol(Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H108N22O12Purity:Min. 95%Molecular weight:1,401.7 g/mol(Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H277N51O49S2Purity:Min. 95%Molecular weight:3,847.43 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H305N57O53S3Purity:Min. 95%Molecular weight:4,344.02 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:<p>Structure/Function: human; Trifluoroacetate salt</p>Formula:C171H266N48O56SPurity:Min. 95%Molecular weight:3,922.3 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>Formula:C7H4Cl3NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:256.47 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/molBradykinin (1-5) trifluoroacetate salt
CAS:<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>Formula:C27H40N8O6Purity:Min. 95%Molecular weight:572.66 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/molUrocortin III (mouse) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C186H312N52O52S2Purity:Min. 95%Molecular weight:4,172.92 g/molZ-L-α-aminobutyric acid
CAS:<p>Z-L-alpha-aminobutyric acid is a homogeneous, optically active, linear phosphinic analogue of alpha-aminobutyric acid. It has been used in the synthesis of phosphinic analogues of cyclosporin and undecapeptides with high yields. The coupling reaction between Z-L-alpha-aminobutyric acid and benzaldehyde was carried out in two steps to produce the desired product. A stepwise condensation between Z-L-alpha-aminobutyric acid and 3,4,5,6 tetrahydropyrimidine was also successful.</p>Formula:C12H15NO4Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:237.25 g/molZ-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O5·C2H4O2Purity:Min. 95%Molecular weight:679.77 g/molH-Pro-Phe-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H30N4O4Purity:Min. 95%Molecular weight:390.48 g/molClofibric acid
CAS:<p>Clofibric acid is a growth factor-β1 (GF-β1) that is an agonist of the nuclear receptor PPARα. Clofibric acid has been shown to inhibit the activity of benzalkonium chloride, an enzyme that degrades DNA, and it also inhibits polymerase chain reactions. Clofibric acid is believed to act as a competitive inhibitor of the ryanodine receptor. It has been shown to have anti-inflammatory properties in transfection experiments with human cells and may be used in analytical methods for measuring clofibric acid levels in pharmaceutical products.</p>Formula:C10H11ClO3Purity:Min. 95%Molecular weight:214.65 g/molDynorphin A (1-13) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H127N25O14Purity:Min. 95%Molecular weight:1,602.97 g/molHemimellitic acid
CAS:<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>Formula:C9H6O6Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:210.14 g/molBombesin (8-14) acetate salt
CAS:<p>Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt is a bifunctional peptide that has been shown to inhibit the growth of prostate cancer cells. Bombesin (8-14) acetate salt H-Trp-Ala-Val-Gly-His-Leu-Met-NH2 acetate salt also has antiinflammatory properties and is used in treating inflammatory diseases. It inhibits collagen synthesis and fibrinogen activation, which may be important in the treatment of autoimmune diseases such as rheumatoid arthritis. Bombesin (8 14) acetate salt H Trp Ala Val Gly His Leu Met NH2 Acetate Salt has been shown to have no effect on healthy tissues when administered systemically.</p>Formula:C38H57N11O7SPurity:Min. 95%Molecular weight:812 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/molDiphenolic acid
CAS:<p>Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol.<br>Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.</p>Formula:C17H18O4Color and Shape:White PowderMolecular weight:286.32 g/molH-Arg-Arg-Arg-OH acetate salt
CAS:<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>Formula:C18H38N12O4Purity:Min. 95%Molecular weight:486.57 g/molProp-1-en-2-ylboronic acid
CAS:<p>Prop-1-en-2-ylboronic acid is a chemical compound that belongs to the group of aromatic hydrocarbons. It is used in pharmaceutical preparations as a monomer and as a chiral building block for the synthesis of oxazolidinones, which are used in medicinal chemistry as protein inhibitors against cancers. Prop-1-en-2-ylboronic acid is also used as a reagent in preparative high performance liquid chromatography. This chemical has shown maximal response against colorectal carcinoma cells and has been shown to be an inhibitor of cholesterol ester transfer.</p>Formula:C3H7BO2Purity:90%MinMolecular weight:85.9 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/molUrocortin (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C206H338N62O64Purity:Min. 95%Molecular weight:4,707.27 g/molPep-1-cysteamide trifluoroacetate salt
CAS:<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C140H202N36O33SPurity:Min. 95%Molecular weight:2,949.39 g/molDiisopropyl azodicarboxylate - 40% toluene solution
CAS:<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>Formula:C8H14N2O4Purity:Min. 95%Color and Shape:Yellow To Yellow Orange LiquidMolecular weight:202.21 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/molH-Gly-Gly-Lys-Ala-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N6O6Purity:Min. 95%Molecular weight:402.45 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formula:C2H2O4•(H2O)2Purity:Min. 95%Molecular weight:126.07 g/molAmyloid β-Protein (1-24) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H183N35O40Purity:Min. 95%Molecular weight:2,876.06 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N4O5Purity:Min. 95%Molecular weight:340.38 g/mol2-Nitrobenzaldiacetate
CAS:<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>Formula:C11H11NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:253.21 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/molMyristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C171H283N45O47SPurity:Min. 95%Molecular weight:3,753.42 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/mol3-Piperidin-1-ylpropanoic acid
CAS:<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>Formula:C8H15NO2Purity:Min. 95%Molecular weight:157.21 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H300N54O58SPurity:Min. 95%Molecular weight:4,348.85 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H99N19O18S2Purity:Min. 95%Molecular weight:1,414.66 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/molPyrrole-2-carboxylic acid
CAS:<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>Formula:C5H5NO2Purity:Min. 95%Molecular weight:111.1 g/molPyromeconic acid
CAS:<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>Formula:C5H4O3Purity:Min. 95%Color and Shape:Off-White To Light (Or Pale) Yellow SolidMolecular weight:112.08 g/molGLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H248N42O52Purity:Min. 95%Molecular weight:3,784.1 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol4-Methoxycarbonylphenylboronic acid
CAS:<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>Formula:C8H9BO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:179.97 g/molDimethyl benzyl carbinol acetate
CAS:<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>Purity:Min. 95%(4-Chloro-3-fluorophenyl)acetic acid ethyl ester
CAS:<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H10ClFO2Purity:Min. 95%Molecular weight:216.64 g/molSubstance P (5-11) trifluoroacetate salt
CAS:<p>Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.</p>Formula:C41H60N10O9SPurity:Min. 95%Molecular weight:869.04 g/mol1-Naphthyl acetate
CAS:<p>1-Naphthyl acetate is a cell-permeable esterase substrate that can be used for the treatment of lymphocytic leukemia, lung cancer, and Alzheimer's disease. It has been shown to inhibit tumor growth in mice by inhibiting cytochrome P450 enzymes. In addition, 1-naphthyl acetate has been found to be effective at inhibiting protein kinase activity in human cells. As a result, it may have potential as a therapeutic agent for leukemia and Alzheimer's disease.</p>Formula:C12H10O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.21 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C183H281N57O54S2Purity:Min. 95%Molecular weight:4,207.67 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/molMyristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H105N17O12Purity:Min. 95%Molecular weight:1,256.58 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS:<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Formula:C124H180N34O31Purity:Min. 95%Molecular weight:2,642.97 g/mol(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester
CAS:<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>Formula:C15H13F2NO4Purity:Min. 95%Molecular weight:309.26 g/molBeclomethasone 21-acetate 17-propionate
CAS:Controlled Product<p>Please enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H35ClO7Purity:Min. 95%Molecular weight:507.02 g/mol(D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt
CAS:<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/molPreptin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C181H268N48O51Purity:Min. 95%Molecular weight:3,932.36 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/molH-Ala-Ala-Ala-OMe acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19N3O4Purity:Min. 95%Molecular weight:245.28 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molAmyloid β-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C182H274N50O55SPurity:Min. 95%Molecular weight:4,074.49 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.67 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molAc-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H66N6O11SPurity:Min. 95%Molecular weight:851.06 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molMating Factor a trifluoroacetate salt
CAS:<p>Please enquire for more information about Mating Factor a trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H114N20O17S·xC2HF3O2Purity:Min. 95%Molecular weight:1,683.97 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molBNP-45 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-45 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C209H354N70O63S2Purity:Min. 95%Molecular weight:4,919.61 g/molα-Casein (90-96) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H64N10O12Purity:Min. 95%Molecular weight:913.03 g/molAlarin (human) trifluoroacetate salt
CAS:<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formula:C127H205N43O35Purity:Min. 95%Molecular weight:2,894.26 g/mol(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/molH-Lys-Lys-Lys-Lys-OH acetate salt
CAS:<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>Formula:C24H50N8O5Purity:Min. 95%Molecular weight:530.7 g/molFormyl-LHRH (2-10) trifluoroacetate salt
CAS:<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H70N16O12Purity:Min. 95%Molecular weight:1,099.2 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H253N51O44S4Purity:Min. 95%Molecular weight:3,627.22 g/molMet-Enkephalin-Arg acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H47N9O8SPurity:Min. 95%Molecular weight:729.85 g/mol2,5-Anhydro-3,4-dideoxy-erythro-hexaric acid - 98%
CAS:<p>The synthesis of 2,5-anhydro-3,4-dideoxy-erythro-hexaric acid (2,5AHDHE) is described in detail. The reaction starts with the condensation of 3,4-dideoxy-erythro-hexose with aldehyde and furfural to give the hemiacetal. The ring opening of this hemiacetal leads to the formation of 2,5AHDHE and furfural. The protonation of 2,5AHDHE leads to proton release and bond cleavage. Furfural is reduced to 5-hydroxymethylfurfural (HMF). HMF is then oxidized to hydroxyl group by H2O2. The hydroxyl group reacts with a second molecule of 2,5AHDHE to form a new molecule of 2,5AHDHE and H2O2. This process can be repeated until</p>Formula:C6H8O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:160.12 g/molEglin c (60-63)-methyl ester acetate salt
CAS:<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>Formula:C19H35N5O7Purity:Min. 95%Molecular weight:445.51 g/molHemokinin 1 (human) trifluoroacetate salt
CAS:<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Formula:C54H84N14O14SPurity:Min. 95%Molecular weight:1,185.4 g/mol2,4,5-Trifluorobenzoic acid
CAS:<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>Formula:C7H3F3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:176.09 g/molH-Lys-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H38N6O5Purity:Min. 95%Molecular weight:478.59 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS:<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>Formula:C23H34N6O6Purity:Min. 95%Molecular weight:490.55 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/molGastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C225H342N60O66SPurity:Min. 95%Molecular weight:4,975.55 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H66Cl2N12O8S2Purity:Min. 95%Molecular weight:1,146.22 g/mol(D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt
CAS:<p>D-Ala2,N-Me-Phe4,methionin(O)-ol5)-Enkephalin trifluoroacetate salt H-Tyr-D-Ala-Gly-N-Me-Phe-methionin(O)-ol trifluoroacetate salt is an analog of the endocannabinoid neurotransmitter, anandamide. It has been shown to be effective in the treatment of autoimmune diseases such as multiple sclerosis and inflammatory bowel disease. D-(3R)-3-[(1S,2R,3R,5R) -3-[2-(2,6 dichlorophenyl)ethenyl] -1H -indole]-1 -butanamine trifluoroacetate salt has been shown to inhibit the replication of a number of viruses including human immunodeficiency virus type 1 (HIV). This drug also inhibits the growth of organisms that are resistant</p>Formula:C29H41N5O7SPurity:Min. 95%Molecular weight:603.73 g/molH-Phe-Met-D-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/mol2-Amino-a-(methoxyimino)-4-thiazoleacetic acid
CAS:<p>2-Amino-a-(methoxyimino)-4-thiazoleacetic acid is a reaction product of cefotaxime and n-dimethyl formamide. It has been shown to be an effective agent for the treatment of wastewater with a high organic content. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid also reacts with chloride ions to form cleavage products that are soluble in water, making it an ideal choice for wastewater treatment. This compound is not toxic and can be used as a drug to treat patients with infections caused by bacteria resistant to other antibiotics. 2-Amino-a-(methoxyimino)-4-thiazoleacetic acid binds to mismatched base pairs in DNA, inhibiting DNA synthesis and causing cell death by apoptosis.</p>Formula:C6H7N3O3SPurity:Min. 95%Molecular weight:201.2 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H224N46O47S9Purity:Min. 95%Molecular weight:3,676.23 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/molCyclopenten-1-ylboronic acid
CAS:<p>Cyclopenten-1-ylboronic acid is a chemical compound that is used in the synthesis of pharmaceuticals. It has been shown to be effective against some viruses, including Hepatitis C virus, and also against some infectious diseases such as malaria. Cyclopenten-1-ylboronic acid binds to cannabinoid receptors and may have therapeutic potential for metabolic disorders such as obesity and diabetes. The diastereomer of this chemical compound may be used as an ophthalmic drug because it has been shown to be a potent vasoconstrictor. The ring structure is similar to other drugs that are used for the treatment of Parkinson's disease, Alzheimer's disease, and epilepsy. Cyclopenten-1-ylboronic acid has two enantiomers, which means that they are mirror images of each other. One enantiomer is more potent than the other one and is more likely to bind with cannabinoid receptors and inhibit viral replication.</p>Formula:C5H9BO2Purity:Min. 95%Molecular weight:111.93 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/molSPLUNC1 (22-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/mol(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H73N11O9S2Purity:Min. 95%Molecular weight:1,192.45 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N7O6·C2H4O2Purity:Min. 95%Molecular weight:677.75 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H246N44O38Purity:Min. 95%Molecular weight:3,273.83 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS:Controlled Product<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O6·C2H4O2Purity:Min. 95%Molecular weight:391.42 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS:<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formula:C20H14O4Purity:Min. 95%Molecular weight:318.32 g/molAlloferon - in acetate salt
CAS:<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17NO4SPurity:Min. 95%Molecular weight:355.41 g/mol3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molH-Lys-Leu-OH acetate salt
CAS:<p>H-Lys-Leu-OH acetate salt is a derivatized amino acid ester that is used for the detection of lysine and leucine. It is used as an analyte in microextraction, with a sensitivity of 0.25 ng/mL, which can be increased to 0.5 ng/mL by derivatization. H-Lys-Leu-OH acetate salt has been used in the detection of acids and bases, particularly carboxylic acids and basic amino acids, respectively.</p>Formula:C12H25N3O3·C2H4O2Purity:Min. 95%Molecular weight:319.4 g/molBNP-32 (porcine) trifluoroacetate salt
CAS:<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>Formula:C149H250N52O44S3Purity:Min. 95%Molecular weight:3,570.1 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS:<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17NO3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:199.25 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Formula:C7H8N2O2·xHClPurity:(%) Min. 60%Color and Shape:PowderMolecular weight:188.61 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C61H83N15O10Purity:Min. 95%Molecular weight:1,186.41 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H294N54O56Purity:Min. 95%Molecular weight:4,278.74 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47·xC2H4O2Purity:Min. 95%Molecular weight:3,355.67 g/molChlorotoxin trifluoroacetate salt
CAS:<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>Formula:C158H249N53O47S11Purity:Min. 95%Molecular weight:3,995.72 g/mol2-Bromoethanesulfonic acid sodium
CAS:<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>Formula:C2H4BrNaO3SPurity:Min. 95%Molecular weight:211.01 g/mol4-Difluoromethoxyphenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H17BF2O3Purity:Min. 95%Molecular weight:270.08 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O56SPurity:Min. 95%Molecular weight:4,240.67 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H216N42O45Purity:Min. 95%Molecular weight:3,183.45 g/mol5-Phenylisoxazole-3-carboxylic acid
CAS:<p>5-Phenylisoxazole-3-carboxylic acid is a phenoxy compound that has been shown to inhibit the growth of tuberculosis bacteria. This drug binds to the postsynaptic potential in the cell membrane and inhibits the effector proteins from interacting with the receptor, preventing neurotransmitter release. The molecular modeling study showed that 5-Phenylisoxazole-3-carboxylic acid interacts with ethyl esters and rifampin, which inhibits xanthine oxidase. Xanthine oxidase inhibitors are used as a treatment for gout and hyperuricemia. 5-Phenylisoxazole-3-carboxylic acid also has fluorimetric properties, which can be used to measure its concentration in biological samples such as urine or plasma. Nitro groups in this drug make it susceptible to oxidation by nitric oxide, which can be monitored using nmr spectra.</p>Formula:C10H7NO3Purity:Min. 95%Molecular weight:189.17 g/mol1-Naphthylphosphoric acid calcium
CAS:<p>1-Naphthylphosphoric acid calcium salt (1NPAC) is a fine chemical that has been used as a building block in the synthesis of complex organic compounds. 1NPAC has been shown to be useful in the production of research chemicals and speciality chemicals. It is also employed as an intermediate for the production of high quality reagents. 1NPAC has versatile uses, as it can be used to synthesize other compounds, such as pharmaceuticals and agrochemicals.</p>Formula:C20H18O8P2•CaPurity:Min. 95%Color and Shape:PowderMolecular weight:488.38 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Formula:C39H64N12O19Purity:Min. 95%Molecular weight:1,004.99 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H73N11O16SPurity:Min. 95%Molecular weight:1,080.21 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/mol2-Mercaptobenzoic acid
CAS:<p>2-Mercaptobenzoic acid is a low potency, but pharmacologically active, compound that has been shown to have antioxidative properties in the mouse tumor model. It has also been shown to cause cancer cell death by reducing the stability of disulfide bonds on proteins and inhibiting the growth of carcinoma cells. 2-Mercaptobenzoic acid is used to treat metabolic disorders, such as diabetes mellitus and hyperlipidemia, and may also be used to treat cancer. 2-Mercaptobenzoic acid is found in human urine at levels of 1.5-3.3μg/mL.<br>2-Mercaptobenzoic acid was first synthesized in 1891 by the German chemist Heinrich Caro (1850-1924).</p>Formula:C7H6O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:154.19 g/mol
