Carboxylic Acids

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tert-Butyl allylcarbamate is a fluorinated, reactive compound that has been used in the synthesis of amines and phosphazenes. Tert-Butyl allylcarbamate is an intermediate for the synthesis of isophthalaldehyde, which can be used to produce polymers and other organic compounds. The reaction rate of tert-butyl allylcarbamate is inhibited by phosphazene, which also inhibits polymerization. Tert-Butyl allylcarbamate has been shown to inhibit transfer reactions involving functional groups such as allylamine, silicon, and fluoroalkyl.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about tert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.</p>

<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties against</p>

<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>

<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>

<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br&gt;br&gt; H-Arg-Arg-OH acetate salt is found in cyanob</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2R,4S)-4-Fluoropyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.</p>

<p>Pamoic acid is a disodium salt of p-aminobenzoic acid. It is an excipient that is considered safe for use in food and pharmaceuticals. Pamoic acid has been used as a preservative and an antioxidant. It prevents the oxidation of fats, oils, and other lipids by reacting with them to form stable compounds. The most common use of pamoic acid is as an anti-spasmodic drug to manage colitis, although it also has been used to treat seizures and spasticity in people with nervous system diseases. Pamoic acid can be used in combination with benzalkonium chloride as a preservative for injectable drugs such as antibiotics or chemotherapy agents. When combined with benzalkonium chloride, pamoic acid acts as a sweetener and particle size modifier.</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>

<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>

<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>

<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VEGFR-KDR/Flk-1 Antagonist Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Acetylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Linoleic acid is a polyunsaturated fatty acid that is an important component of cell membranes. It has been shown to inhibit oxidative injury and improve mitochondrial functions. Linoleic acid also has a role in energy metabolism, as it is the precursor for biosynthesis of eicosanoids and arachidonic acid. The physiological effects of linoleic acid have been studied using a model system consisting of isolated rat adipose tissue and mitochondria. This model system has been used to investigate the inhibitory properties of linoleic acid on caproic acid-induced lipid peroxidation. Linoleic acid has also been shown to have anion radical scavenging activity when in the presence of iron. This compound can be analyzed using gas chromatography-mass spectrometry (GC-MS) based on its chemical composition, which consists mainly of linear 18-carbon chains with two double bonds at positions 9 and 12.</p>

<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>

<p>3-Keto-4-etiocholenic acid is a type of fatty acid that is naturally found in the human body. It is produced by the oxidation of other types of fatty acids and is an intermediate in the synthesis of sex hormones. 3-Keto-4-etiocholenic acid can be synthesized by recombinant methods, which are used to produce proteins for research purposes. It has been shown to have cytostatic effects, which may be due to its irreversible inhibition of enzymes involved in biological function.</p>

<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.</p>

<p>Acetate salt</p>

<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>4-Fluorophenoxyacetic acid is a chemical compound that is used as an insecticide. It has been shown to be effective against the planthopper and ipomoea, two agricultural pests. 4-Fluorophenoxyacetic acid binds to the active site of a specific protein in the insect's cells, inhibiting its function and causing cell death. 4-Fluorophenoxyacetic acid also inhibits the growth of human breast cancer cells in culture. The molecular weight of this compound is 180.2 g/mol and has a melting point of 185°C with a boiling point of 232°C at atmospheric pressure. 4-Fluorophenoxyacetic acid can be synthesized by reacting phenol with acetic anhydride in the presence of palladium complexes and nitrogen atoms. The reaction mechanism for this synthesis is nucleophilic addition to form a covalent bond between the nitrogen atom and sulfur atom on one side of the</p>

<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.</p>

<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>