Carboxylic Acids

<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>

<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.</p>

<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>

<p>Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.</p>

<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>

<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.</p>

<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>

<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>

<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4,9,10-Perylenetetracarboxylic diimide is a model system for studying the mechanism of protonated pyridine. It is a bicyclic heterocycle that contains two phenyl rings and one imide group. The nitrogen atoms in the molecule form hydrogen bonds with other molecules and can be substituted with chlorine or bromine. 3,4,9,10-Perylenetetracarboxylic diimide has been shown to have chemical stability under conditions of hydrochloric acid and heat. This compound also has a high melting point and is not soluble in water. 3,4,9,10-Perylenetetracarboxylic diimide has been used to study the reaction mechanisms of chemical reactions involving light emission. This compound absorbs light at wavelengths longer than 400 nm (e.g., ultraviolet) and emits light at wavelengths shorter than 400 nm (e.g.,</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>3-Benzoyl acrylic acid is an organic compound that is the product of a chemical reaction between benzaldehyde and acetic anhydride. It contains a carboxylic acid group, an hydroxyl group, a nitro group, and a particle. 3-Benzoyl acrylic acid has been shown to inhibit the growth factor epidermal growth factor (EGF). This inhibition occurs by binding to the receptor for EGF on the cell membrane and blocking its activation. 3-Benzoyl acrylic acid also inhibits fatty acid synthesis and mitochondrial membrane potential, which may be due to its ability to form ester hydrochloride.</p>

<p>Please enquire for more information about Adrenomedullin 5 (primate) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>

<p>Intermediate in the synthesis of sitagliptin</p>

<p>D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.</p>

<p>L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.</p>

<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>

<p>Silver trifluoroacetate is a chemical compound that is a silver salt of trifluoroacetic acid. Silver trifluoroacetate is a white crystalline solid, soluble in water and alcohols, but insoluble in ethers. It has the chemical formula AgCF3CO2H. The crystal structure of silver trifluoroacetate has been determined by x-ray diffraction techniques and found to be orthorhombic with space group Pbam. The molecule consists of two 5-membered heteroaromatic rings, one containing carbon atoms and the other containing nitrogen atoms. The nitrogen atom is bonded to six hydrogen atoms and three fluorine atoms, while the carbon atom is bonded to four oxygen atoms and one fluorine atom. Synthesis methods for this compound include reacting silver nitrate with sodium carbonate in water vapor at 120°C.</p>

<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Pyreneboronic acid is a fluorescent derivative of boronic acid. It has been shown to have synergistic effects with other compounds, such as glucose monitoring. 1-Pyreneboronic acid is used in the preparation of a fluorescent probe for use in dna duplex assays. The fluorescence properties of this compound are affected by the presence of hydroxy groups and benzyl groups, making it useful for protein detection and identification. This compound can be prepared using the suzuki coupling reaction and it has been shown that it has an effect on cell line raw264.7 cells.</p>

<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>

<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>

<p>Phenyl pyruvic acid is a sodium salt of phenylpyruvic acid that can be synthesized from phenylalanine, an amino acid. It has been shown to have antioxidant and anti-inflammatory properties. Phenyl pyruvic acid was found to inhibit oxidative injury caused by sodium nitroprusside in the rat brain, liver, and heart. Phenyl pyruvic acid also increased the activity of 3t3-l1 preadipocytes and improved energy metabolism in these cells. The synthesis of phenylpyruvate is catalyzed by a decarboxylase enzyme and it can be converted into insulin or phenylalanine.</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>Orotic acid anhydrous is a hydrogen bonding interaction that can be found in biological systems. It plays a role in the physiological effects of orotic acid, which is a metabolite of uridine and an intermediate in the synthesis of pyrimidine nucleotides. Orotic acid has antimicrobial properties and has been shown to inhibit enzyme activities involved in energy metabolism, such as polymerase chain reaction (PCR) and adenosine triphosphate (ATP) synthase. Orotic acid also inhibits the growth of bacteria, fungi, and parasites. Orotic acid anhydrous is used for treating myocardial infarcts or brain functions. The untreated group was given no treatment at all.</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>