
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C150H246N44O38Purity:Min. 95%Molecular weight:3,273.83 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H151N31O26S2Purity:Min. 95%Molecular weight:2,099.44 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19F2NO4Purity:Min. 95%Molecular weight:315.31 g/mol4-(Piperidin-4-yl)benzoic acid hydrochloride
CAS:<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16ClNO2Purity:Min. 95%Molecular weight:241.71 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H211N41O31SPurity:Min. 95%Molecular weight:2,720.25 g/molChromone-2-carboxylic acid
CAS:<p>Chromone-2-carboxylic acid is a hydrochloric acid analog that is a prodrug for the formation of the active metabolite chromone-2,4-dihydroxybenzoic acid. Chromone-2-carboxylic acid has been shown to have anti-inflammatory properties in vitro and in vivo. It has also been shown to inhibit leukotriene synthesis by blocking the binding of LTC4 to its receptor.</p>Formula:C10H6O4Purity:Min. 95%Molecular weight:190.15 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS:<p>3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.</p>Formula:C8H14O4S2Purity:Min. 97%Color and Shape:Colorless Clear LiquidMolecular weight:238.33 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS:<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formula:C20H14O4Purity:Min. 95%Molecular weight:318.32 g/molH-Asn-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O4Purity:Min. 95%Molecular weight:289.29 g/molSorbin (147-153) amide (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Sorbin (147-153) amide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H58N10O9Purity:Min. 95%Molecular weight:738.88 g/molPseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/mol3-Methylsalicylic acid
CAS:<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>Formula:C8H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:152.15 g/mol2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid
CAS:<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BF2O4Purity:Min. 95%Molecular weight:201.92 g/mol(D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt
CAS:<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/molMethyl carbamate
CAS:<p>Methyl carbamate is a carbamate that inhibits a number of enzymes, including mitochondrial membrane potential, cell nuclei, and dinucleotide phosphate. It also inhibits the synthesis of DNA, RNA, and proteins. Methyl carbamate has been shown to inhibit the growth of infectious diseases such as malaria and tuberculosis. It is a potent inhibitor of hyperproliferative diseases such as cancer. Methyl carbamate is used in analytical chemistry to determine the amount of an unknown compound in a sample by measuring its concentration with mass spectrometry or other methods. The compound can be prepared in various ways depending on the type of analysis needed. Methyl carbamate is usually prepared by reacting methyl iodide with sodium cyanide at 150 °C for 24 hours.</p>Formula:C2H5NO2Purity:Min. 95%Molecular weight:75.07 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Ile-Arg-OH acetate salt
CAS:<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>Formula:C12H25N5O3Purity:Min. 95%Molecular weight:287.36 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C86H125N27O29Purity:Min. 95%Molecular weight:2,001.08 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Formula:C70H104N22O18S·C2HF3O2Purity:Min. 95%Color and Shape:Red SolidMolecular weight:1,687.8 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C52H68N10O12S2Purity:Min. 95%Molecular weight:1,089.29 g/mol3-Hydroxy-4-methyl-2-nitro-benzoic acid
CAS:<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>Purity:Min. 95%4-Acetamidophenyl boronic acid
CAS:<p>4-Acetamidophenyl boronic acid is a cross-coupling reagent that has been used in the synthesis of a variety of organic molecules. The reaction is stereoselective and proceeds with high yield. 4-Acetamidophenyl boronic acid has also been used to synthesize amides and azobenzenes, which can be substituted with chloride or uv irradiation to give chloroazobenzene or benzotriazole respectively. 4-Acetamidophenyl boronic acid has shown potent inhibition against the enzyme cyclooxygenase 2 (COX2) and acidic hydrolysis.</p>Purity:Min. 95%3,5-Diiodothyroformic acid
CAS:<p>3,5-Diiodothyroformic acid is a fine chemical that is used as a versatile building block in organic synthesis. It is also an intermediate for research chemicals and speciality chemicals. In addition to its use as a reagent, 3,5-Diiodothyroformic acid has been shown to be useful as a building block for the synthesis of pharmaceuticals and agricultural chemicals.</p>Formula:C13H8I2O4Purity:Min. 95%Molecular weight:482.01 g/mol6-Bromohexanoic acid methyl ester
CAS:<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>Formula:C7H13BrO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:209.08 g/molGastrin I (rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C94H128N22O31S2Purity:Min. 95%Molecular weight:2,126.28 g/moltert-Butyl cis-4-hydroxycyclohexylcarbamate
CAS:<p>Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.</p>Formula:C11H21NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:215.29 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C189H284N54O58SPurity:Min. 95%Molecular weight:4,272.67 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Formula:C65H93N15O26Purity:Min. 95%Molecular weight:1,500.52 g/molH-Gly-Tyr-NH2 acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O5Purity:Min. 95%Molecular weight:297.31 g/mol(D-Ser4)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/mol3-Acetylphenylboronic acid, pinacol ester
CAS:<p>Please enquire for more information about 3-Acetylphenylboronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19BO3Purity:Min. 95%Molecular weight:246.11 g/molAcetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt
CAS:<p>Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt is synthesized from a tetrapeptide. It has been shown to be neurotrophic and to stimulate the uptake of dopamine. Acetyl-(D-Lys2, Sar 3)-Melanotropin-Potentiating Factor acetate salt Ac-Lys-D-Lys-Sar-Glu-OH acetate salt has also been shown to be an analog of the growth factor nerve growth factor (NGF) and have similar effects on muscle tissue.</p>Formula:C22H40N6O8Purity:Min. 95%Molecular weight:516.59 g/molGanoderic acid G
CAS:Controlled Product<p>Ganoderic acid G is a natural compound that has been extracted from the mushroom Ganoderma lucidum. It has been shown to have anticancer, anti-inflammatory, immunomodulatory, and antioxidant properties. Ganoderic acid G inhibits cancer cell proliferation by inhibiting fatty acid synthesis and promoting apoptosis in cancer cells. It also inhibits the production of inflammatory cytokines such as tumor necrosis factor-α (TNF-α). Ganoderic acid G has been found to inhibit the production of reactive oxygen species in human liver cells.</p>Formula:C30H44O8Purity:Min. 95%Color and Shape:SolidMolecular weight:532.67 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS:<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17NO3Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:199.25 g/molAmyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/molEthyl 4-amino-2-mercaptopyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 4-amino-2-mercaptopyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H9N3O2SPurity:Min. 95%Molecular weight:199.23 g/mol2-Methoxyethyl acetoacetate
CAS:<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formula:C7H12O4Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:160.17 g/mol6-Maleimidocaproic acid N-hydroxysuccinimide ester
CAS:<p>6-Maleimidocaproic acid N-hydroxysuccinimide ester (6MCA-NHS) is a fluorescent probe that reacts with the hydroxyl group of fatty acids in human serum and other biological samples. 6MCA-NHS binds to the carboxylic acid group at the end of a fatty acid molecule, forming a covalent bond. This process generates light emission that can be detected by a fluorescence probe to measure changes in pH or other chemical properties within the solution. 6MCA-NHS has been used as a tumor treatment, where laser ablation is used to break up tumor cells and release 6MCA-NHS into the cytoplasm. The drug can then bind to DNA molecules and inhibit protein synthesis, which results in cell death.</p>Formula:C14H16N2O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:308.29 g/mol5'-Chloro-2'-hydroxy-3'-nitro-[1,1'-biphenyl]-3-carboxylic acid
CAS:<p>Please enquire for more information about 5'-Chloro-2'-hydroxy-3'-nitro-[1,1'-biphenyl]-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H8ClNO5Purity:Min. 95%Molecular weight:293.66 g/molEndothelin-2 (human, canine) acetate
CAS:<p>Acetate salt</p>Formula:C115H160N26O32S4Purity:Min. 95%Molecular weight:2,546.92 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formula:C2H2O4•(H2O)2Purity:Min. 95%Molecular weight:126.07 g/mol1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS:<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H35FN2O7Purity:Min. 95%Molecular weight:590.64 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H252N44O48S•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,652.1 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molH-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H32N8O9Purity:Min. 95%Molecular weight:504.5 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H73N11O16SPurity:Min. 95%Molecular weight:1,080.21 g/molH-Pro-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O5Purity:Min. 95%Molecular weight:447.53 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H83N17O11Purity:Min. 95%Molecular weight:1,062.27 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molSecretin (porcine) acetate salt
CAS:Controlled Product<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Formula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Formula:C7H8N2O2·xHClPurity:(%) Min. 60%Color and Shape:PowderMolecular weight:188.61 g/molChlorotoxin trifluoroacetate salt
CAS:<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>Formula:C158H249N53O47S11Purity:Min. 95%Molecular weight:3,995.72 g/molε-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt
CAS:<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>Formula:C16H15N2NaO9SPurity:Min. 95%Molecular weight:434.35 g/molGalanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H210N42O43Purity:Min. 95%Molecular weight:3,157.41 g/molMagnesium acetate anhydrous
CAS:<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>Formula:C4H6MgO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:142.39 g/mol4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid
CAS:<p>4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.</p>Formula:C9H5F3N2O2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:230.14 g/mol2-Bromo-4,5-dimethoxybenzoic acid
CAS:<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>Formula:C9H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:261.07 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS:<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>Formula:C9H9BrO3Purity:Min. 95%Color and Shape:PowderMolecular weight:245.07 g/mol3-Bromobenzoic acid
CAS:<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>Formula:C7H5BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:201.02 g/mol(D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/molAmyloid β-Protein (33-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (33-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H74N10O11SPurity:Min. 95%Molecular weight:915.15 g/molSomatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/molNeuropeptide Y (22-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H139N29O21Purity:Min. 95%Molecular weight:1,903.2 g/mol(Lys7)-Dermorphin acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Lys7)-Dermorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H57N9O9Purity:Min. 95%Molecular weight:843.97 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS:<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H15BrN2O2SPurity:Min. 95%Molecular weight:319.22 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C141H235N47O41Purity:Min. 95%Molecular weight:3,244.67 g/molEthyl diphenylacetate
CAS:<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>Formula:C16H16O2Purity:Min. 95%Molecular weight:240.3 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/molACV trifluoroacetate salt
CAS:<p>ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.</p>Formula:C14H25N3O6SPurity:Min. 95%Molecular weight:363.43 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molMethyl 4-tert-butylphenylacetate
CAS:<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>Formula:C13H18O2Purity:Min. 95%Molecular weight:206.28 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H60N10O15S2Purity:Min. 95%Molecular weight:1,177.27 g/molNociceptin trifluoroacetate salt
CAS:<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809.04 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molC5a Anaphylatoxin (human) trifluoroacetate salt )
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C350H578N108O107S8Purity:Min. 95%Molecular weight:8,267.53 g/mol3-Methoxyphenylboronic acid
CAS:<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:151.96 g/molBombesin trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C71H110N24O18SPurity:Min. 95%Molecular weight:1,619.85 g/molAlloferon 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H69N19O15Purity:Min. 95%Molecular weight:1,128.16 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS:<p>Intermediate in the synthesis of afatinib</p>Formula:C6H12ClNO2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:165.62 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/molN-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molGAP 26 trifluoroacetate salt
CAS:<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Formula:C70H107N19O19SPurity:Min. 95%Molecular weight:1,550.78 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/mol3-[(2-Aminoethyl)dithio]propionic acid
CAS:<p>Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.</p>Formula:C5H11NO2S2Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:181.28 g/mol4-Methylbenzyl acetate
CAS:<p>4-Methylbenzyl acetate is a monocarboxylic acid that is an oxidation product of benzyl esters. It has been found to be a suitable catalyst for the oxidation of wastewater containing monocarboxylic acids, including acetic acid, propionic acid and butyric acid. The catalytic mechanism of 4-methylbenzyl acetate was found to be an acylation reaction in which the carboxyl group of 4-methylbenzyl acetate acts as an acylating agent with the hydrogen atom of the substrate. The reaction mechanism for this process is similar to that for other types of carboxylic acids, such as propionate and butyrate. 4-Methylbenzyl acetate also has functional groups that allow it to act as both a base and a nucleophile in addition to its ability to act as an acylating agent.</p>Formula:C10H12O2Purity:Min. 95%Molecular weight:164.2 g/mol1-Methyl-1H-imidazole-5-carboxylic acid
CAS:<p>1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.</p>Formula:C5H6N2O2Purity:Min. 95%Molecular weight:126.11 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS:<p>Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H75Na2O8PPurity:Min. 95%Molecular weight:748.96 g/molKyotorphin acetate salt
CAS:<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/mol4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester
CAS:<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H23ClN2O3Purity:Min. 95%Molecular weight:374.86 g/mol3,4,9,10-Perylenetetracarboxylic dianhydride
CAS:<p>3,4,9,10-Perylenetetracarboxylic dianhydride is a dianhydride that is used in the production of polyesters. It has been shown to form herringbone structures when it is heated and forms kinetic energy. The formation of these structures can be induced by laser ablation. 3,4,9,10-Perylenetetracarboxylic dianhydride also has a redox potential that is more positive than most other organic compounds. This compound can undergo intermolecular hydrogen bonding with glycol ethers and copper chloride and can react with nitrogen atoms to produce photocurrent in model systems. 3,4,9,10-Perylenetetracarboxylic dianhydride also has hydroxyl groups that are important for the biosynthesis of fatty acids.</p>Formula:C24H8O6Purity:Min. 95%Color and Shape:Red PowderMolecular weight:392.32 g/mol(R)-methyl pyrrolidine-3-carboxylate hydrochloride
CAS:<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molEtiroxate carboxylic acid
CAS:<p>Please enquire for more information about Etiroxate carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H13I4NO4Purity:Min. 95%Molecular weight:790.9 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS:<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>Formula:C52H77N17O14Purity:Min. 95%Molecular weight:1,164.27 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molβ-Casomorphin (1-4) (bovine) acetate salt
CAS:<p>Beta-Casomorphin (1-4) is a tetrapeptide that is derived from the amino acid sequence of bovine beta-casein. It inhibits the binding of opioid receptors and has been shown to have an inhibitory effect on muscle activity. Beta-Casomorphin (1-4) has also been shown to have a stabilizing effect on the genotype, which may be due to its ability to bind to DNA. Beta-Casomorphin (1-4) is detectable in urine and can be used as a marker for assessing the effectiveness of treatments in infants with Colic.</p>Formula:C28H34N4O6Purity:Min. 95%Molecular weight:522.59 g/molPAR-2 (1-6) (human) trifluoroacetate salt
CAS:<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molTRAF6 Control Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H232N34O42Purity:Min. 95%Molecular weight:3,051.53 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H160N34O27Purity:Min. 95%Molecular weight:2,210.5 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H283N51O53SPurity:Min. 95%Molecular weight:4,125.63 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H273N49O52S2Purity:Min. 95%Molecular weight:3,935.45 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N7O6·C2H4O2Purity:Min. 95%Molecular weight:677.75 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C85H128N32O20Purity:Min. 95%Molecular weight:1,918.13 g/mol2-Amino-6-fluorobenzoic acid ethyl ester
CAS:<p>2-Amino-6-fluorobenzoic acid ethyl ester is a chemical that can be used as a building block in the synthesis of more complex compounds. It is a versatile intermediate and can be used to synthesize other important compounds, such as pharmaceuticals. This compound has been shown to be useful for the preparation of 2-amino-4,6-difluorobenzoic acid ethyl ester and many other derivatives. The colorless solid is soluble in ether and dichloromethane.</p>Formula:C9H10FNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:183.18 g/mol(Deamino-Cys1,b-(3-pyridyl)-D-Ala2,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.</p>Formula:C45H63N15O11S2Purity:Min. 95%Molecular weight:1,054.21 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/molMethyl-N,N-diethyldithiocarbamate
CAS:<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>Formula:C6H13NS2Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:163.31 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molVasonatrin Peptide (VNP) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C123H198N36O36S3Purity:Min. 95%Molecular weight:2,853.31 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/molThr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt
CAS:<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>Formula:C145H234N52O44S3Purity:Min. 95%Molecular weight:3,505.93 g/molγ-Polyglutamic acid sodium - MW 800-1500
CAS:<p>Polymer of glutamic acid</p>Formula:(C5H9NO3)nPurity:Min. 95%Color and Shape:Powder(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/molBNP-26 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H198N42O36S2Purity:Min. 95%Molecular weight:2,869.25 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/mol(R)-2-Hydroxy-4-phenylbutanoic acid
CAS:<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molEndothelin-3 (human, mouse, rabbit, rat) acetate
CAS:<p>Acetate salt</p>Formula:C121H168N26O33S4•(C2H4O2)xPurity:Min. 95%Molecular weight:2,643.05 g/molH-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>Formula:C21H31ClN6O3Purity:Min. 95%Molecular weight:450.96 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O37SPurity:Min. 95%Molecular weight:3,543.12 g/mol5-Bromo-2-chlorobenzoic acid
CAS:<p>Intermediate in the synthesis of dapagliflozin</p>Formula:C7H4BrClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:235.46 g/mol3-(4-Fluorobenzoyl)propionic acid
CAS:<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>Formula:C10H9FO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:196.18 g/molPropanedioic acid 1-methyl ester
CAS:<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>Formula:C4H6O4Purity:Min. 95%Color and Shape:Colourless To Pale Yellow Clear LiquidMolecular weight:118.09 g/mol7-Hydroxyheptanoic acid
CAS:<p>7-Hydroxyheptanoic acid is a fatty acid that has the hydroxyl group on the seventh carbon. It is biosynthesized from the hydroxylation of heptanal, which is catalyzed by a monooxygenase. The hydroxyl group in 7-hydroxyheptanoic acid can be oxidized to form a carboxylic acid (e.g., 7-ketoheptanoic acid). 7-hydroxyheptanoic acid can also be used as a coating material because it has functional groups and is biodegradable and metal ion free.</p>Formula:C7H14O3Purity:Min. 95%Molecular weight:146.18 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C190H286N54O56Purity:Min. 95%Molecular weight:4,222.63 g/mol(D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molPeptide YY (3-36) trifluoroacetate salt
CAS:<p>Peptide YY (PYY) is a 36-amino acid peptide. It is cleaved from the larger protein, pancreatic polypeptide, by the enzyme dipeptidyl peptidase IV and circulates in plasma as PYY(3-36). The postprandial plasma levels of PYY are dose-dependent and increase with increasing doses of injected PYY. This response reflects the physiological effects of this hormone. A linear regression analysis revealed that PYY(3-36) has a significant effect on body weight loss and body mass index in humans. The effective dose for weight loss is yet to be determined, but it may be higher than 10 μg/kg/day.</p>Formula:C176H272N52O54Purity:Min. 95%Molecular weight:3,980.36 g/molACTH (1-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N8O5Purity:Min. 95%Molecular weight:540.61 g/molpTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C108H173N27O35Purity:Min. 95%Molecular weight:2,409.69 g/mol4,4-Difluorocyclohexaneacetic acid
CAS:<p>Please enquire for more information about 4,4-Difluorocyclohexaneacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12F2O2Purity:Min. 95%Molecular weight:178.18 g/molAc-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C95H162N20O26Purity:Min. 95%Molecular weight:2,000.42 g/mol(D-His2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/mol(D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H99N19O15Purity:Min. 95%Molecular weight:1,338.56 g/molpTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C414H672N122O128S2Purity:Min. 95%Molecular weight:9,470.64 g/molDermcidin-1L (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C210H359N57O71Purity:Min. 95%Molecular weight:4,818.44 g/mol4-Hydroxy-1,3-benzenedisulfonic acid
CAS:<p>4-Hydroxy-1,3-benzenedisulfonic acid (4HBDS) is a reactive molecule that is used as a model system for the study of chain reactions. 4HBDS does not undergo hydrolysis or oxidation and is stable in water. It can be prepared by the reaction of nitrate with acetate extract and has been shown to react with diazonium salts to form an analytical method for nitrite ion. 4HBDS reacts with hydrochloric acid to generate proton and significant interactions are observed at pH values between 1 and 3.</p>Purity:Min. 95%Palmitoleic acid methyl ester
CAS:<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>Formula:C17H32O2Purity:Min. 95%Molecular weight:268.43 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H47N9O5Purity:Min. 95%Molecular weight:529.68 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H81N15O19Purity:Min. 95%Molecular weight:1,388.44 g/molUndecanoic acid
CAS:<p>Undecanoic acid is a fatty acid that belongs to the class of saturated fatty acids. It has been shown to have a number of biological effects, including lowering cholesterol levels, preventing and treating opportunistic fungal infections, and as a contraceptive. Undecanoic acid is also known to increase the body mass index (BMI) in mice and may be useful in the treatment of coronary heart diseases in humans.</p>Formula:C11H22O2Purity:Min. 95%Color and Shape:PowderMolecular weight:186.29 g/mol(2-Amino-2-oxoethoxy)acetic acid
CAS:<p>2-Amino-2-oxoethoxy)acetic acid is a product that can be used as a transport agent in the process of extracting glycosides. It has been shown to have strong adsorption properties and is able to extract glycosides from plant material. 2-Amino-2-oxoethoxy)acetic acid has a high affinity for calcium, which is an important component in the adsorption mechanism.</p>Formula:C4H7NO4Purity:Min. 95%Molecular weight:133.1 g/mol(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:<p>(Ala1)-PAR-4 (1-6) (mouse) trifluoroacetate salt H-Ala-Tyr-Pro-Gly-Lys-Phe-OH trifluoroacetate salt is a potent inhibitor of protein kinase C, and has been shown to inhibit the growth of prostate cancer cells. It also inhibits phosphorylation of epidermal growth factor receptors, which leads to lower levels of epidermal growth factor in the cell. This drug also has antiplatelet effects and may be used as an antiplatelet agent for patients with vascular disease or diabetes.</p>Formula:C34H47N7O8Purity:Min. 95%Molecular weight:681.78 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/mol(Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C193H293N53O58SPurity:Min. 95%Molecular weight:4,315.78 g/mol3-Pyridineboronic acid
CAS:<p>3-Pyridineboronic acid is an antimicrobial agent that is used to treat bacterial and fungal infections. 3-Pyridineboronic acid is a prodrug that is metabolized to its active form, pyridinium boronate. This drug has been shown to be effective in the treatment of hypoxic tumors in mice, which are resistant to other anticancer drugs. 3-Pyridineboronic acid also has acidic properties and can be used as an antiseptic for the treatment of skin and eye infections. It can also be used as a hydrogen bonding partner when combined with halides, such as chloride or bromide ions. The drug binds to human serum proteins and forms an acidic complex that prevents bacterial growth by inhibiting protein synthesis. 3-Pyridineboronic acid also inhibits prostate cancer cells by competitively inhibiting the enzyme 4-pyridinylboronic acid reductase (4PBAR).</p>Formula:C5H6BNO2Purity:Min. 95%Molecular weight:122.92 g/molpTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (7-34) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H247N49O37Purity:Min. 95%Molecular weight:3,364.91 g/mol4-Methoxyphenyl boronic acid
CAS:<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:PowderMolecular weight:151.96 g/molAcetyl-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H284N50O61SPurity:Min. 95%Molecular weight:4,228.61 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:<p>Structure/Function: human; Trifluoroacetate salt</p>Formula:C171H266N48O56SPurity:Min. 95%Molecular weight:3,922.3 g/molAngiotensin A trifluoroacetate salt
CAS:<p>Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH is a drug that has been shown to be effective in treating chronic kidney disease and heart failure. It is a synthetic peptide that mimics the activity of angiotensin II, an important regulator of blood pressure. Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH binds to the angiotensin receptor, which causes vasoconstriction and increases the release of soluble guanylate cyclase. This drug also inhibits the production of matrix metalloproteinases, which break down collagen and other extracellular proteins.</p>Formula:C49H71N13O10Purity:Min. 95%Molecular weight:1,002.17 g/mol6,8-Dichlorochromone-2-carboxylic acid
CAS:<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>Formula:C10H4Cl2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:259.04 g/molC-Type Natriuretic Peptide (1-53) (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C251H417N81O71S3Purity:Min. 95%Molecular weight:5,801.7 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C152H244N40O42SPurity:Min. 95%Molecular weight:3,335.87 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/mol3-Cyano-2-methylphenylboronic acid
CAS:<p>3-Cyano-2-methylphenylboronic acid is a high quality compound that can be used as a reagent, intermediate, or building block in the synthesis of complex compounds. This chemical is also useful as a speciality chemical and research chemical. 3-Cyano-2-methylphenylboronic acid has versatile uses in organic synthesis due to its versatility in reactions and building blocks.</p>Formula:C8H8BNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:160.97 g/molAc-Leu-Glu-His-Asp-AMC trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>Formula:C33H41N7O11Purity:Min. 95%Molecular weight:711.72 g/molTIMP-2 (145-168) (human, bovine) trifluoroacetate salt
<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C131H189N33O35S3Purity:Min. 95%Molecular weight:2,882.3 g/molGlucagon (19-29) (human, rat, porcine) trifluoroacetate salt
CAS:<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>Formula:C61H89N15O18SPurity:Min. 95%Molecular weight:1,352.52 g/mol(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C142H240N44O38Purity:Min. 95%Molecular weight:3,171.7 g/molEndomorphin-2 trifluoroacetate salt
CAS:<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C406H670N122O126S3Purity:Min. 95%Molecular weight:9,372.61 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>Formula:C36H74N24O7Purity:Min. 95%Molecular weight:955.13 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molCorticostatin I (rabbit) trifluoroacetate salt
CAS:<p>Please enquire for more information about Corticostatin I (rabbit) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C163H259N63O44S6Purity:Min. 95%Molecular weight:3,997.59 g/molMaxadilan trifluoroacetate salt
CAS:<p>Maxadilan trifluoroacetate salt is a low-potency drug that binds to the GABA receptor and affects the central nervous system. Maxadilan trifluoroacetate salt is structurally related to leishmaniasis, an infectious disease caused by protozoa of the genus Leishmania. Maxadilan trifluoroacetate salt has been shown to prevent the development of autoimmune diseases in mice, including systemic lupus erythematosus, experimental autoimmune encephalomyelitis, and collagen-induced arthritis. Maxadilan trifluoroacetate salt has also been shown to be effective against cutaneous lesions in mice infected with Leishmania major. The mechanism of action is not yet known but may be due to its ability to influence mitochondrial membrane potential or fatty acid metabolism.</p>Formula:C291H466N86O94S6Purity:Min. 95%Molecular weight:6,865.73 g/molEthyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate
CAS:<p>Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate is an anticancer agent that belongs to the class of formamidines. It is synthesized by refluxing ethyl 4-hydroxyphenylacetic acid with hexamethylenetetramine and acetic acid in ethanol. After purification, it is converted to its active form by reacting with hydrochloric acid. Ethyl 2-(4-hydroxyphenyl)-4-methylthiazole-5-carboxylate prevents the growth of cancer cells in culture by preventing DNA synthesis, which prevents RNA and protein synthesis. This agent has also been found to suppress paclitaxel production in cultured human breast cancer cells.</p>Formula:C13H13NO3SPurity:Min. 95%Molecular weight:263.31 g/mol(Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS:<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29NO7SPurity:Min. 95%Molecular weight:475.56 g/mol3-Fluoro-4-nitrobenzoic acid
CAS:<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molLys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H114N18O22Purity:Min. 95%Molecular weight:1,595.79 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/molD,L-Mevalonic acid lactone
CAS:<p>Mevalonic acid lactone is a natural compound that has been shown to have an effect on mitochondrial membrane potential. It has also been shown to inhibit the drug transporter P-glycoprotein, which is involved in the transport of drugs out of cells. Mevalonic acid lactone has also demonstrated an anti-inflammatory effect, as it inhibits the production of TNF-α and IL-6 in human serum. This compound also possesses antioxidant properties, which may be due to its hydroxyl group and phenoxy groups. Mevalonic acid lactone can be used as a model system for sesquiterpene lactones, and it is able to improve mitochondrial functions by inhibiting pyrazole ring formation.</p>Formula:C6H10O3Purity:Min. 95%Color and Shape:PowderMolecular weight:130.14 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/molN-α-Boc-Nβ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid
CAS:<p>Please enquire for more information about N-alpha-Boc-Nbeta-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N2O6Purity:Min. 95%Molecular weight:368.42 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molHexanedioic acid
CAS:<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>Formula:C6H10O4Color and Shape:White Off-White PowderMolecular weight:146.14 g/mola-(Trichloromethyl)benzyl acetate
CAS:<p>a-(Trichloromethyl)benzyl acetate is an organic compound with the formula CHClCOCH. It is a colorless liquid which is soluble in organic solvents. This compound exhibits oxidative carbonylation activity, and has been shown to be used for the coating of particles, detergent compositions, and analytical methods. The microcapsules are prepared by encapsulating a fatty acid in a glycol ether. The health effects of this compound are not well understood but it is believed that it may have some carcinogenic properties.</p>Formula:C10H9Cl3O2Purity:Min. 95%Molecular weight:267.54 g/mol4-(2'-N-Boc-hydrazino)benzoic acid
CAS:<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molPAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molMethyl 6-oxo-1,6-dihydropyridazine-3-carboxylate
CAS:<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H6N2O3Purity:Min. 95%Molecular weight:154.12 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/mol
