Carboxylic Acids

<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ethyl imidazole-2-carboxylate is a β-glucosidase inhibitor that has shown selectivity for cancer cells. This drug inhibits the activity of β-glucosidase, an enzyme that catalyzes the hydrolysis of terminal non-reducing β-D-glucose residues from oligo-, di-, and polysaccharides, which are substrates for glycosylation. Dasatinib is a type of drug that inhibits Bcr-Abl tyrosine kinase and is used in the treatment of chronic myeloid leukemia and other cancers. The inhibition of this enzyme may lead to increased levels of thymidine (a nucleotide) and therefore, DNA synthesis. Dasatinib also blocks the function of ribonucleotide reductases, which are enzymes that reduce ribonucleotides to deoxyribonucleotides. This mechanism prevents DNA replication by inhibiting the production of new DNA</p>

<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>

<p>H-DL-Val-Leu-Arg-pNA acetate salt is a natriuretic that is used to treat chronic kidney failure. It has an inhibitory effect on serine protease and epidermal growth factor, which are enzymes involved in the production of atrial natriuretic peptide (ANP). The drug also reduces blood pressure by inhibiting the activity of angiotensin II, which is a potent vasoconstrictor. H-DL-Val-Leu-Arg-pNA acetate salt has been shown to increase urea nitrogen levels by inhibiting the activity of alkaline phosphatase, which breaks down ammonia in the liver.</p>

<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Methylboronic acid pinacol ester is an orally administered compound that inhibits the activity of peptidases and imidazole derivatives. It is used as a medicinal preparation for the treatment of cancer and other diseases. Methylboronic acid pinacol ester has been shown to inhibit the growth of bacteria, including Gram-positive bacteria such as methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens. This compound also has an inhibitory effect on hydroxyl group metabolism, which may be related to its anti-inflammatory properties.</p>

<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Pyrimidine-carboxylic acid is a biologically active molecule that can be found in the human body. It is a derivative of pyrimidine, which belongs to the group of purines. 2-Pyrimidine-carboxylic acid has been shown to inhibit the nicotinic acetylcholine receptor and α7 nicotinic acetylcholine receptor, which are receptors for acetylcholine. This molecule also has antihypertensive activity and has been shown to have therapeutic effects in psychotic disorders. 2-Pyrimidine-carboxylic acid binds to picolinic acid, which is an important intermediate in the metabolism of tryptophan, and hydroxyl group, which is essential for many biological functions. It also reacts with copper ions and forms a complex that is x-ray crystal structure confirmed. This complex may be used as a herbicide resistance inducer or as a chemical species for receptor binding studies or chemical reactions.</p>

<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>

<p>Mercaptoacetic acid sodium salt (MAS) is an oxidation catalyst that is used to convert ethyl alcohol into acetic acid. It has been shown to be a good catalyst for the oxidation of hydroxyl groups in the presence of metal hydroxides or inorganic acids, such as sodium carbonate. MAS has also been shown to be toxic to human serum and is not recommended for use in humans. The toxicity of MAS may be due to its ability to react with fatty acids and form mercaptans, which are volatile compounds that can cause irritation. Mercaptoacetic acid sodium salt reacts with potassium dichromate and forms mercaptans and other products, which may contribute to its toxicity.</p>

<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>

<p>Trans-2,5-difluorocinnamic acid is a monomer that belongs to the group of organic acids. It is used as a solvent and in analytical methods. Trans-2,5-difluorocinnamic acid is also used to transport other substances and can be used in reactions with other molecules. Trans-2,5-difluorocinnamic acid has been shown to be neuropathic and has been tested for its ability to cause cataracts, but has not shown any evidence of mutagenicity.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>

<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>

<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Hydroxy-4-phenylbutyric acid ethyl ester is a chiral compound that can be synthesized by an asymmetric synthesis reaction. The compound has been shown to inhibit the enzyme phosphodiesterase, which plays a role in the regulation of cardiac function. (R)-2-Hydroxy-4-phenylbutyric acid ethyl ester has also been shown to induce proliferation of recombinant cells and to bind to monoclonal antibodies against human C5a receptor. It is soluble in organic solvents such as isooctane or pyridine and stable under acidic or basic conditions.</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>

<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>

<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about H-Ala-Ala-Ala-OMe acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>

<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>

<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (403-407) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Acetylpiperidine-1-carboxylic acid tert-butyl ester is a tert-butyl ester of 4-acetylpiperidine. It can be prepared by the reaction of sodium azide with chloroform and tert-butyl alcohol. The resulting product is a white solid that can be used as an intermediate in organic synthesis.</p>

<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>

<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>

<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>

<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.</p>

<p>Please enquire for more information about H-D-Val-Leu-Lys-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-L-alpha-aminobutyric acid is a synthetic amino acid that is used as a linker in solid-phase peptide synthesis. It is also used to synthesize analogs of the serine protease NS3, which are postulated to inhibit hepatitis C virus replication by preventing the release of viral RNA from infected cells. Fmoc-L-alpha-aminobutyric acid has been shown to have anti-viral activity against the influenza virus and HIV.</p>

<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (1-40) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl oxazol-5-ylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>

<p>Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth</p>

<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>

<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>