Inhibitors
Inhibitors are molecules that bind to enzymes, receptors, or other proteins to reduce or block their biological activity. These compounds are widely used in research to study biological pathways, understand disease mechanisms, and develop therapeutic drugs. Inhibitors play a crucial role in the treatment of various diseases, including cancer, cardiovascular diseases, and infections. At CymitQuimica, we provide a diverse range of high-quality inhibitors to support your research in biochemistry, cell biology, and pharmaceutical development.
Subcategories of "Inhibitors"
- Angiogenesis(2,833 products)
- Apoptosis(6,315 products)
- Cell Cycle/Checkpoint(4,875 products)
- Chromatin/Epigenetics(2,612 products)
- Cytoskeletal Signaling(1,566 products)
- DNA Damage/DNA Repair(2,872 products)
- Endocrinology/Hormones(3,754 products)
- Enzyme(3,672 products)
- GPCR/G-Protein(9,014 products)
- Immunology and Inflammation(3,900 products)
- Influenza Virus(300 products)
- JAK/STAT signaling(415 products)
- MAPK Signaling(1,256 products)
- Membrane Transporter/Ion Channel(3,154 products)
- Metabolism(10,139 products)
- Microbiology/Virology(7,620 products)
- Neuroscience(10,369 products)
- Other Inhibitors(35,852 products)
- Oxidation-Reduction(40 products)
- PI3K/Akt/mTOR Signaling(1,430 products)
- Proteases/Proteasome(1,691 products)
- Stem Cell and Derivatives(733 products)
- Tyrosine Kinase/Adaptors(1,983 products)
- Ubiquitination(1,726 products)
Show 16 more subcategories
Found 66522 products of "Inhibitors"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Bombolitin III
CAS:Bombolitin III, an antimicrobial peptide sourced from bumblebee venom, possesses lytic activity against erythrocytes and liposomes [1].Formula:C87H157N23O19SColor and Shape:SolidMolecular weight:1861.39Amp1EP9
Amp1EP9: antimicrobial peptide, non-toxic, combats multidrug-resistant bacteria.Formula:C90H173N21O16Color and Shape:SolidMolecular weight:1805.47Carboxypeptidase C
CAS:Carboxypeptidase C removes COOH-terminal amino acids and others in peptides for biochemical studies.Color and Shape:SolidDynamin inhibitory peptide TFA
Dynamin inhibitory peptide TFA hinders dynamin-amphiphysin interaction and endocytosis, affecting dopamine D3 and GABA A receptors.Formula:C49H81F3N18O16Color and Shape:SolidMolecular weight:1235.27Tianeptine Metabolite MC5 sodium
CAS:Tianeptine metabolite MC5, an active derivative of the atypical antidepressant tianeptine produced through β-oxidation, exhibits selective G protein activationFormula:C19H20ClN2O4S·NaColor and Shape:SolidMolecular weight:430.88ELA-11(human) TFA
ELA-11(human) TFA: apelin receptor agonist, K i =14 nM, inhibits cAMP, stimulates β-arrestin, from ELA-32 fragment.Formula:C60H91F3N16O15S2Color and Shape:SolidMolecular weight:1397.58Protein Kinase C (19-31)
CAS:Protein Kinase C (19-31), a PKC inhibitor derived from PKCa, has a serine at position 25 and tests PKC activity.Formula:C67H118N26O16Purity:98%Color and Shape:Lyophilized PowderMolecular weight:1543.82Amyloid β-Protein (3-42)
CAS:Amyloid β-Protein (3-42), the precursor of Pyr peptide, serves as the foundation of the amyloid template block in Alzheimer's disease when modified toColor and Shape:SolidGnRH Associated Peptide (1-24), human
CAS:GnRH Associated Peptide (GAP) (1-24), human, is the 1-24 fragment of hGAP linked to LH-RH via a 3 amino acid site.Formula:C117H190N32O43Color and Shape:SolidMolecular weight:2732.95LVGRQLEEFL (mouse) (TFA)
G* peptide, also known as LVGRQLEEFL (mouse) TFA, is a segment corresponding to amino acids 113 to 122 ([113,122] apoJ) of apolipoprotein J.Color and Shape:Odour SolidChitinase
CAS:Chitinase, found in bacteria, fungi, animals, plants, is a glycosyl hydrolase that hydrolyzes chito-oligosaccharides.Color and Shape:SolidHemokinin 1, human TFA
Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.Formula:C56H85F3N14O16SColor and Shape:SolidMolecular weight:1299.42Delaminomycin A
Delaminomycin A is a useful organic compound for research related to life sciences and the catalog number is T125790.Formula:C29H43NO6Color and Shape:SolidMolecular weight:501.664Cyclosporin A-Derivative 3
CAS:Cyclosporin A-Derivative 3 is a derivative of Cyclosporin A with calcineurin inhibition [1] .Formula:C63H111N11O12Color and Shape:SolidMolecular weight:1214.62Loureiriol
CAS:Loureiriol is a natural product for research related to life sciences. The catalog number is TN4454 and the CAS number is 479195-44-3.Formula:C16H14O6Purity:98%Color and Shape:SolidMolecular weight:302.2819-Oxocinobufagin
CAS:19-Oxocinobufagin is a natural product from Bufo bufo gargarizans Cantor.Formula:C26H32O7Purity:98%Color and Shape:SolidMolecular weight:456.535Benzoylgomisin P
CAS:Benzoylgomisin P is a natural product for research related to life sciences. The catalog number is TN3494 and the CAS number is 129445-43-8.Formula:C30H32O9Purity:98%Color and Shape:SolidMolecular weight:536.57LKKTETQ
CAS:LKKTETQ, a peptide segment within thymosin β 4, constitutes the protein's active site responsible for actin binding, cell migration, and wound healing.Formula:C36H66N10O13Color and Shape:SolidMolecular weight:846.981D-GsMTx4
TRPC1/6 & Piezo2 inhibitor; mimics GsMTx4; blocks ~70% mechanosensitive currents; aids in mouse heart attack models; protease-resistant.Color and Shape:SoildTC14012
CAS:CXCR4 antagonist and ACKR3 (CXCR7) agonist (EC50 = 350 nM for CXCR7).Formula:C90H140N34O19S2Purity:98%Color and Shape:SolidMolecular weight:2066.43BIM-23190 hydrochloride
BIM-23190 hydrochloride, somatostatin analog, SSRT2/5 agonist, Ki: 0.34 nM (SSTR2), 11.1 nM (SSTR5). Used in cancer, acromegaly research.Color and Shape:Liquid13C C16 Sphingomyelin (d18:1/16:0)
CAS:'13C-enriched C16 Sphingomyelin is a standard for quantifying C16 sphingomyelin by MS. Common in eggs; less in brain/milk; interacts with cholesterol.'Formula:C39H79N2O6PColor and Shape:SolidMolecular weight:704.035Panomifene HCl
CAS:Panomifene HCl is a selective anti-estrogenic compound with antitumor activity for the treatment of breast cancer.Formula:C25H25ClF3NO2Purity:99.53%Color and Shape:SoildMolecular weight:463.925-Fluorouracil-13C,15N2
CAS:5-Fluorouracil-13C,15N2 is a standard for quantifying 5-fluorouracil via GC/LC-MS and blocks DNA synthesis, causing cell apoptosis.Formula:C4H3FN2O2Color and Shape:SolidMolecular weight:133.057HS024 TFA
HS024, a selective MC4 receptor antagonist, exhibits affinity with Ki values of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1 receptors, respectivelyFormula:C60H80F3N19O12S2Color and Shape:SolidMolecular weight:1380.52GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37TRAF6 peptide
CAS:TRAF6 peptide inhibits TRAF6-p62, blocks TrkA ubiquitination, and shows promise for neurological disease research.Formula:C145H238N34O44Color and Shape:SolidMolecular weight:3161.64Violet bnp
CAS:Violet Bnp is an agent of dye.Formula:C41H44N3NAO6S2Purity:98%Color and Shape:Fine PowderMolecular weight:761.93PG-931 TFA
PG-931 TFA, a potent MC4 receptor agonist (IC50 0.58 nM), excels in selectivity and helps reverse hemorrhagic shock in vivo.Formula:C61H86F3N15O13Color and Shape:SolidMolecular weight:1294.42Decahydro-1-naphthol
CAS:Decahydro-1-naphthol is a biochemical.Formula:C10H18OColor and Shape:SolidMolecular weight:154.25Cyclo(Tyr-Leu)
CAS:Cyclo(Tyr-Leu) is a cyclic dipeptide from Portulaca oleracea Linn with cytotoxicity, antifungal, and anticoagulant activities.Formula:C15H20N2O3Purity:99.86%Color and Shape:SolidMolecular weight:276.33Ref: TM-TN6444
1mg63.00€5mg137.00€10mg205.00€25mg356.00€50mg522.00€100mg713.00€1mL*10mM (DMSO)129.00€c[Arg-Arg-Arg-Arg-Nal-Nal-Nal]
CAS:Compound 9C is effective against resistant bacteria, with MICs: MRSA 3.1, S. aureus 3.1, P. aeruginosa 12.5, E. coli 25 μg/mL.Formula:C63H81N19O7Color and Shape:SolidMolecular weight:1216.44Etelcalcetide
CAS:Etelcalcetide (AMG 416), a synthetic peptide CaSR activator, treats secondary hyperparathyroidism in hemodialysis patients.Formula:C38H73N21O10S2Purity:98%Color and Shape:SolidMolecular weight:1048.26H-Ile-Pro-Pro-OH hydrochloride
CAS:H-Ile-Pro-Pro-OH HCl, milk peptide, blocks ACE with 5 μM IC50. Antihypertensive.Formula:C16H28ClN3O4Color and Shape:SolidMolecular weight:361.86AI 3-26464
CAS:AI 3-26464 is an agent of biochemical.
Formula:C20H16O6Purity:98%Color and Shape:SolidMolecular weight:352.342Maximin Hv
Maximin Hv, an antimicrobial peptide sourced from the Bombina maxima toad [1], exhibits potent activity against a variety of microorganisms.Color and Shape:Odour SolidSV40 T-Ag-derived NLS peptide
CAS:This peptide, a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.Formula:C66H111N19O18SPurity:98%Color and Shape:SolidMolecular weight:1490.77Dansylphenylalanine
CAS:Dansylphenylalanine is a typical fluorescent analyte.Formula:C21H22N2O4SColor and Shape:SolidMolecular weight:398.48Substance P (alligator)
CAS:Substance P from alligator: a neuropeptide with structure Arg-Pro-Arg-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2.Formula:C63H98N20O13SColor and Shape:SolidMolecular weight:1375.64LCI peptide
LCI peptide exhibits antimicrobial and antibacterial properties, effectively targeting plant pathogens such as Xanthomonas and Pseudomonas, as well as combatingFormula:C259H378N62O69Color and Shape:SolidMolecular weight:5464.15Cecropin A (1-7)-Melittin A (2-9)
CAS:Cecropin A-Melittin peptide combats Gram+ & Gram- bacteria, has antimalarial effects, no hemolysis like bee venom.Formula:C89H152N22O15Color and Shape:SolidMolecular weight:1770.3Amylin, amide, human TFA
Amylin, a 37-amino acid human hormone, moderates glucose regulation by reducing glucagon, delaying digestion, and increasing satiety.Formula:C167H262F3N51O57S2Color and Shape:SolidMolecular weight:4017.3Pramlintide
CAS:Pramlintide, a polypeptide analog of human amylin, is an antidiabetic agent with antineoplastic properties in colorectal cancer.Color and Shape:SolidCyclo(Tyr-Val)
CAS:Cyclo(Tyr-Val) is a natural product for research related to life sciences. The catalog number is TN6690 and the CAS number is 21754-25-6.Formula:C14H18N2O3Color and Shape:SolidMolecular weight:262.3Isooxoflaccidin
CAS:Isooxoflaccidin is a natural product for research related to life sciences. The catalog number is TN5785 and the CAS number is 135010-50-3.Formula:C16H12O5Purity:98%Color and Shape:SolidMolecular weight:284.26Ac-RYYRWK-NH2 TFA
CAS:Ac-RYYRWK-NH2: potent, specific NOP receptor partial agonist with 0.071 nM affinity; no affinity for μ/κ/δ-opioid receptors.Formula:C51H70F3N15O11Color and Shape:SolidMolecular weight:1126.21PtdIns-(1,2-dioctanoyl) (sodium salt)
CAS:PtdIns phosphates, a minor membrane lipid fraction, are vital for cell signaling. Synthetic PtdIns-(1,2-dioctanoyl) has C8:0 fatty acids and high solubility.Formula:C25H47NaO13PColor and Shape:SolidMolecular weight:609.602(Phe2,Orn8)-Oxytocin acetate
(Phe2,Orn8)-Oxytocin acetate: V1 agonist with EC50 of 280 nM for rabbit epididymis contractility.Formula:C44H69N13O13S2Color and Shape:SolidMolecular weight:1052.23CART(55-102)(rat) TFA
Rat CART(55-102) TFA suppresses appetite, links to leptin/neuropeptide Y, and may induce anxiety/stress.Formula:C228H368F3N65O67S7Color and Shape:SolidMolecular weight:5373.23,4,6-Trichlorocatechol
CAS:TCC, a metabolite from Aroclor-1254 induced rats' livers, forms due to industrial pollutants.Formula:C6H3Cl3O2Color and Shape:SolidMolecular weight:213.44Hedycoronen A
CAS:Hedycoronen A/B inhibit IL-6/IL-12, IC50=4.1-9.1 uM & TNF-α, IC50=12.7-46.0 uM, promising anti-inflammatory agents.Formula:C21H30O3Purity:98%Color and Shape:SolidMolecular weight:330.46Neuropeptide Y (3-36) (porcine)
CAS:Neuropeptide Y (3-36) (porcine) is a potent, selective agonist at NPY Y2 receptors, increasing feeding in rats.Formula:C176H271N53O54Color and Shape:SolidMolecular weight:3993.36Hydroxy-PEG20-Boc
Hydroxy-PEG20-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C47H94O23Purity:98%Color and Shape:SolidMolecular weight:1027.24OM99-2
CAS:OM99-2, an 8-residue peptidomimetic, binds memapsin 2 with 9.58 nM Ki; promising for Alzheimer's research.Formula:C41H64N8O14Color and Shape:SolidMolecular weight:893.005The K4 peptide
CAS:K4 peptide exhibits potent antimicrobial properties, effectively targeting both Gram-positive and Gram-negative bacteria, particularly pathogenic strains likeFormula:C87H132N18O15Color and Shape:SolidMolecular weight:1670.09Somatostatin-25
CAS:Somatostatin: a brain/pancreas hormone binding receptors, with anxiolytic, antiepileptic, and appetite-suppressing effects.Formula:C127H191N37O34S3Purity:98%Color and Shape:SolidMolecular weight:2876.3γ-1-Melanocyte Stimulating Hormone (MSH), amide
γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and bloodFormula:C72H97N21O14SColor and Shape:SolidMolecular weight:1512.9MUC1, mucin core
CAS:MUC1: Type I transmembrane glycoprotein, overexpressed and abnormally glycosylated in cancer, binds ICAM-1 domain 1.Formula:C61H101N19O24Color and Shape:SolidMolecular weight:1484.588m-Anisidine, 4-(2-ethylbutoxy)-, hydrobromide
CAS:m-Anisidine, 4-(2-ethylbutoxy)-, hydrobromide is a bioactive chemical.Formula:C13H22BrNO2Color and Shape:SolidMolecular weight:304.22Citrostadienol
CAS:Citrostadienol shows cytotoxic activity against B16F10 melanoma cells.Formula:C30H50OColor and Shape:SolidMolecular weight:426.72Wedeliatrilolactone A
CAS:Wedeliatrilolactone A is a natural product from Wedelia trilobata.Formula:C23H32O9Purity:98%Color and Shape:SolidMolecular weight:452.49Prepro-ANF (56-92), human
CAS:Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.Formula:C173H270N44O57Color and Shape:SolidMolecular weight:3878.26FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15Antibacterial agent 53
CAS:Antibacterial agent 53 (example 19) is a antibacterial agent.Formula:C15H17N5O6SColor and Shape:SolidMolecular weight:395.39Org 24598 lithium salt
CAS:Org 24598 lithium salt is a GlyT-1 inhibitor of glycine transporter 1.Formula:C19H19F3LiNO3Color and Shape:SolidMolecular weight:373.3FR252384
CAS:FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).Formula:C18H17N3Purity:98%Color and Shape:SolidMolecular weight:275.35JPS016
CAS:JPS016: benzamide VHL E3-ligase PROTAC, degrades HDAC1/2, triggers apoptosis in HCT116 cells.Formula:C48H63N7O8SColor and Shape:SolidMolecular weight:898.12Amylin (IAPP), feline TFA
Amylin (IAPP), feline TFA: 37-amino acid peptide; inhibits insulin/glucagon; secreted by pancreatic β-cells.Formula:C167H271F3N52O56S2Color and Shape:SolidMolecular weight:4024.47Aclerastide
CAS:Aclerastide, an angiotensin receptor agonist, decreases fibrosis in wounds; effect increases with use duration, blocked by AT antagonist.Formula:C42H64N12O11Color and Shape:SolidMolecular weight:913.03β-Amyloid (1-43)(human) TFA
β-Amyloid (1-43)(human) TFA exhibits greater aggregation tendencies and heightened toxicity compared to its well-established counterpart, Aβ1-42.Formula:C209H319F3N56O64SColor and Shape:SolidMolecular weight:4729.21Peptide YY (PYY) (3-36), porcine TFA
Peptide YY (PYY) (3-36), porcine TFA, functions as a gut hormone that serves as a Y2 receptor agonist, effectively reducing appetite [1].Formula:C176H272N52O54·C2HF3O2Color and Shape:SolidMolecular weight:4094.44AMPR-22
CAS:AMPR-22, an antimicrobial peptide, binds to bacterial membranes to induce permeabilization and has demonstrated efficacy in a murine sepsis model induced byFormula:C98H168N28O22S3Color and Shape:SolidMolecular weight:2186.75Syntide 2 TFA
Syntide 2 (TFA) is a CaMKII substrate that selectively hinders GA response without affecting other plant processes.Formula:C70H123N20F3O20Color and Shape:SolidMolecular weight:1621.84CP-289
CAS:CP-289 is a potent C5a receptor antagonist with IC50 of 1 μM.Formula:C30H35ClN2O2Purity:99.97%Color and Shape:SoildMolecular weight:491.06Ref: TM-T60161
1mg105.00€5mg236.00€10mg349.00€25mg528.00€50mg710.00€100mg1,009.00€200mg1,341.00€1mL*10mM (DMSO)264.00€Nimacimab
CAS:Nimacimab is a recombinant humanized monoclonal antibody. It can improve diabetes and non-alcoholic steatohepatitis.Purity:SDS-PAGE:95.3%;SEC-HPLC:97.7%Color and Shape:LiquidMolecular weight:144.97 kDaβ-Amyloid (1-38), mouse, rat
CAS:β-Amyloid (1-38), derived from mice and rats, is a chemical compound comprising 38 amino acids, specifically residues 1-38 of the Aβ peptide.Color and Shape:SolidPKCζ/ι pseudosubstrate inhibitor
CAS:PKCζ/ι pseudosubstrate inhibitor demonstrates comprehensive inhibitory activity across the protein kinase C (PKC) family and is associated with the induction ofFormula:C76H128N30O16Color and Shape:SolidMolecular weight:1718.02Enterostatin(human,mouse,rat)
CAS:Enterostatin, human, mouse, rat is a pentapeptide that reduces fat intake.Formula:C21H36N8O6Purity:98%Color and Shape:SolidMolecular weight:496.569Acetyl-Amylin (8-37) (human)
CAS:Acetyl-Amylin (8-37) (human) is a specific amylin antagonist [1] .Formula:C140H218N42O46Color and Shape:SolidMolecular weight:3225.48S-acetyl-PEG3-alcohol
CAS:S-acetyl-PEG3-alcohol is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formula:C8H16O4SPurity:98%Color and Shape:SolidMolecular weight:208.28SYNV-cyclo(CGGYF)
SYNV-cyclo(CGGYF), a S. hominis C5 peptide, inhibits S. aureus and aids in studying related inflammation.Formula:C46H58N10O13SColor and Shape:SolidMolecular weight:991.08Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.Formula:C165H252N44O48SColor and Shape:SolidMolecular weight:3652.1Kisspeptin-54(human) TFA
Endogenous kisspeptin-54(human) TFA targets KISS1/GPR54 receptors; Ki: 1.81 nM (rat), 1.45 nM (human); inhibits metastasis, boosts gonadotropin.Formula:C258H401N79O78·C2HF3O2Color and Shape:SolidMolecular weight:5971.45Ophiobolin B
CAS:Ophiobolin B is a sesterterpene Helminthosporium oryzae metabolite, inhibits proton extrusion from maize coleoptiles.Formula:C25H38O4Purity:98%Color and Shape:SolidMolecular weight:402.57Piaselenole
CAS:Piaselenole could determine the traces of selenium.Formula:C6H4N2SeColor and Shape:SolidMolecular weight:183.07Orexin B, rat, mouse TFA
Orexin B, rat/mouse TFA, activates OX1-R & OX2-R receptors, influencing food intake, energy, and sleep regulation.Formula:C128H216F3N45O36SColor and Shape:SolidMolecular weight:3050.42Termicin
Termicin, an antimicrobial peptide derived from Pseudacanthotermes spiniger, exhibits activity against gram-positive bacteria, filamentous fungi, and yeasts [1Color and Shape:Odour SolidHypoglaunine D
CAS:Hypoglaunine D, an anti-HIV analogue of Triptonine B, inhibits HIV in H9 cells with an EC50 of 22 μg/ml.Formula:C41H47NO19Color and Shape:SolidMolecular weight:857.81Folate sodium
CAS:Folate sodium, a B vitamin, boosts blood production and treats/prevents folate deficiency and megaloblastic anemia.Formula:C19H18N7NaO6Color and Shape:SolidMolecular weight:463.38[Sar4] Substance P (4-11)
'[Sar4] Substance P (4-11) is a C-terminus fragment and agonist of Substance P.'Formula:C44H65N11O10SColor and Shape:SolidMolecular weight:940.12Hemigossypol
CAS:Hemigossypol is a precursor of gossypol biosynthesis.Formula:C15H16O4Color and Shape:SolidMolecular weight:260.29Brain Derived Basic Fibroblast Growth Factor (1-24)
CAS:FGF basic 1-24: synthetic peptide with anti-bacterial and anti-HBV properties, used in infectious and immune disease research.Formula:C118H173N31O33Color and Shape:SolidMolecular weight:2553.82Polistes mastoparan
CAS:Polistes mastoparan, an antimicrobial peptide, enhances K+ efflux in S. aureus cells and reduces cell viability, exhibiting an EC50 of 5 μM [1].Formula:C77H127N21O18Color and Shape:SolidMolecular weight:1634.96MM 419447
CAS:MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist showing potential in IBS-C research.Formula:C50H70N14O19S6Color and Shape:SolidMolecular weight:1363.55Heneicosapentaenoic Acid
CAS:HPA: a 21:5 ω-3 fatty acid in fish oil & B. pennata, similar to EPA but with an extra carbon; inhibits arachidonic acid, affects PGHS activity.Formula:C21H32O2Color and Shape:SolidMolecular weight:316.48NAADP tetrasodium salt
CAS:Ca2+ mobilizing agentFormula:C21H27N6O18P3Purity:98%Color and Shape:SolidMolecular weight:744.39Tet-20
CAS:Tet-20, a synthetic cathelicidin-derived peptide with biological activity, has been evaluated for its efficacy as an infection-resistant coating on medicalFormula:C78H141N31O14SColor and Shape:SolidMolecular weight:1769.22Dendrotoxin K
CAS:Dendrotoxin K blocks Kv1.1 channels, modulating glutamate release in CA3 neurons by controlling presynaptic spike timing.Formula:C294H462N84O75S6Color and Shape:SolidMolecular weight:6559.66ProTx III
Potent Nav1.7 inhibitor (IC50=2.5nM); blocks Nav1.1/1.2/1.3/1.6; no Cav/nAChR impact at 5μM; analgesic; counters scorpion toxin OD1.Formula:C162H246N52O43S6Purity:98%Color and Shape:SolidMolecular weight:3802.41Tryglysin A
CAS:Triglysin A is an antimicrobial peptide that inhibits the growth of other Streptococci [1].Formula:C37H54N12O10Color and Shape:SolidMolecular weight:826.9
![c[Arg-Arg-Arg-Arg-Nal-Nal-Nal]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76226.webp&w=3840&q=75)
