Inhibitors
Inhibitors are molecules that bind to enzymes, receptors, or other proteins to reduce or block their biological activity. These compounds are widely used in research to study biological pathways, understand disease mechanisms, and develop therapeutic drugs. Inhibitors play a crucial role in the treatment of various diseases, including cancer, cardiovascular diseases, and infections. At CymitQuimica, we provide a diverse range of high-quality inhibitors to support your research in biochemistry, cell biology, and pharmaceutical development.
Subcategories of "Inhibitors"
- Angiogenesis(2,519 products)
- Apoptosis(5,786 products)
- Cell Cycle/Checkpoint(4,444 products)
- Chromatin/Epigenetics(2,235 products)
- Cytoskeletal Signaling(1,382 products)
- DNA Damage/DNA Repair(2,823 products)
- Endocrinology/Hormones(3,499 products)
- Enzyme(3,639 products)
- GPCR/G-Protein(8,314 products)
- Immunology and Inflammation(3,516 products)
- Influenza Virus(296 products)
- JAK/STAT signaling(404 products)
- MAPK Signaling(1,199 products)
- Membrane Transporter/Ion Channel(2,786 products)
- Metabolism(9,417 products)
- Microbiology/Virology(6,967 products)
- Neuroscience(9,920 products)
- Other Inhibitors(37,931 products)
- Oxidation-Reduction(41 products)
- PI3K/Akt/mTOR Signaling(1,399 products)
- Proteases/Proteasome(1,596 products)
- Stem Cell and Derivatives(832 products)
- Tyrosine Kinase/Adaptors(2,015 products)
- Ubiquitination(1,646 products)
Show 16 more subcategories
Found 66627 products of "Inhibitors"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MUC1, mucin core
CAS:<p>MUC1: Type I transmembrane glycoprotein, overexpressed and abnormally glycosylated in cancer, binds ICAM-1 domain 1.</p>Formula:C61H101N19O24Color and Shape:SolidMolecular weight:1484.588Citrostadienol
CAS:<p>Citrostadienol shows cytotoxic activity against B16F10 melanoma cells.</p>Formula:C30H50OColor and Shape:SolidMolecular weight:426.72Wedeliatrilolactone A
CAS:<p>Wedeliatrilolactone A is a natural product from Wedelia trilobata.</p>Formula:C23H32O9Purity:98%Color and Shape:SolidMolecular weight:452.49Prepro-ANF (56-92), human
CAS:<p>Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.</p>Formula:C173H270N44O57Color and Shape:SolidMolecular weight:3878.26FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15FR252384
CAS:<p>FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).</p>Formula:C18H17N3Purity:98%Color and Shape:SolidMolecular weight:275.35Acetyl-Amylin (8-37) (human)
CAS:<p>Acetyl-Amylin (8-37) (human) is a specific amylin antagonist [1] .</p>Formula:C140H218N42O46Color and Shape:SolidMolecular weight:3225.48SYNV-cyclo(CGGYF)
<p>SYNV-cyclo(CGGYF), a S. hominis C5 peptide, inhibits S. aureus and aids in studying related inflammation.</p>Formula:C46H58N10O13SColor and Shape:SolidMolecular weight:991.08Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
<p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>Formula:C165H252N44O48SColor and Shape:SolidMolecular weight:3652.1Kisspeptin-54(human) TFA
<p>Endogenous kisspeptin-54(human) TFA targets KISS1/GPR54 receptors; Ki: 1.81 nM (rat), 1.45 nM (human); inhibits metastasis, boosts gonadotropin.</p>Formula:C258H401N79O78·C2HF3O2Color and Shape:SolidMolecular weight:5971.45Ophiobolin B
CAS:<p>Ophiobolin B is a sesterterpene Helminthosporium oryzae metabolite, inhibits proton extrusion from maize coleoptiles.</p>Formula:C25H38O4Purity:98%Color and Shape:SolidMolecular weight:402.57Orexin B, rat, mouse TFA
<p>Orexin B, rat/mouse TFA, activates OX1-R & OX2-R receptors, influencing food intake, energy, and sleep regulation.</p>Formula:C128H216F3N45O36SColor and Shape:SolidMolecular weight:3050.42Termicin
<p>Termicin, an antimicrobial peptide derived from Pseudacanthotermes spiniger, exhibits activity against gram-positive bacteria, filamentous fungi, and yeasts [1</p>Color and Shape:Odour SolidFolate sodium
CAS:<p>Folate sodium, a B vitamin, boosts blood production and treats/prevents folate deficiency and megaloblastic anemia.</p>Formula:C19H18N7NaO6Color and Shape:SolidMolecular weight:463.38[Sar4] Substance P (4-11)
<p>'[Sar4] Substance P (4-11) is a C-terminus fragment and agonist of Substance P.'</p>Formula:C44H65N11O10SColor and Shape:SolidMolecular weight:940.12Hemigossypol
CAS:<p>Hemigossypol is a precursor of gossypol biosynthesis.</p>Formula:C15H16O4Color and Shape:SolidMolecular weight:260.29TPP-1 TFA
<p>TPP-1 TFA is a high-affinity PD-L1 inhibitor (KD=95nM) that boosts T-cell function to curb tumor growth.</p>Formula:C109H151F3N34O34S2Color and Shape:SolidMolecular weight:2602.69Polybia-MP1
CAS:<p>Polybia-MP1 is an antimicrobial mastoparan peptide [1] .</p>Formula:C78H132N20O19Color and Shape:SolidMolecular weight:1654.01Esculentin 1A
CAS:<p>Esculentin 1A, a potent antimicrobial peptide (AMP) derived from frog skin, demonstrates significant in vitro activity against Pseudomonas [1].</p>Formula:C212H369N59O60S3Color and Shape:SolidMolecular weight:4800.75Z-VRPR-FMK TFA
<p>Z-VRPR-FMK (TFA), a tetrapeptide, irreversibly inhibits MALT1, protecting against influenza A.</p>Formula:C33H50F4N10O8Color and Shape:SolidMolecular weight:790.81Navamepent
CAS:<p>Navamepent (RX-10045), a resolvin E1 analog, is anti-inflammatory, reduces corneal inflammation, epithelial damage, and aids tissue repair; treats dry eye.</p>Formula:C18H24O4Purity:99.03% - 99.09%Color and Shape:SolidMolecular weight:304.38α-CGRP(human) TFA
<p>α-CGRP(human) TFA is a 37-amino acid regulatory neuropeptide that is extensively located within the central and peripheral nervous system, functioning as a</p>Formula:C165H268F3N51O51S2Color and Shape:SolidMolecular weight:3903.33Cy5-N3 triethylamine salt
<p>Cy5-N3 triethylamine salt is a turnip-based fluorescent dye.CY5-N3 can be used to study cellular imaging.</p>Formula:C42H61N7O7S2Purity:96.56%Color and Shape:SoildMolecular weight:840.11Neuropeptide Y (3-36) (human, rat)
CAS:<p>Neuropeptide Y (3-36) is a Y2 receptor agonist that limits norepinephrine release, produced by DPP4 from NPY.</p>Formula:C175H269N53O54SColor and Shape:SolidMolecular weight:4011.5Alsactide
CAS:<p>Alsactide, an adrenocorticotropic hormone (ACTH) agonist and a heptadecapeptide analogue, is utilized in the study of the central nervous system [1].</p>Formula:C99H155N29O21SColor and Shape:SolidMolecular weight:2119.53AL 34662
CAS:<p>AL 34662 is a selective and potent 5-HT2A receptor agonist with IC50s of 0.77 nM and 1.5 nM for rat and human 5-HT2 receptors, respectively.AL 34662 is also a</p>Formula:C10H13N3OPurity:99.77%Color and Shape:SolidMolecular weight:191.23(D-Asp1)-Amyloid β-Protein (1-42)
CAS:<p>(D-Asp1)-Amyloid β-Protein (1-42), a peptide fragment of amyloid β-protein (Aβ), serves as the primary constituent of vascular and parenchymal amyloid deposits</p>Formula:C203H311N55O60SColor and Shape:SolidMolecular weight:4514.04Histatin-3
CAS:<p>Histatin-3, a 32-amino-acid peptide, exhibits potent antimicrobial activities and serves as a substrate for proprotein convertase 1 (PC1), where it is primarily</p>Formula:C178H258N64O48Color and Shape:SolidMolecular weight:4062.35Pol (476-484), HIV-1 RT Epitope
CAS:<p>Pol (476-484), HIV-1 RT Epitope is a biologically active peptide and represents the dominant HLA A*0201-restricted epitope within HIV-1 reverse transcriptase (</p>Formula:C46H78N12O12Color and Shape:SolidMolecular weight:991.18MDP1 acetate
<p>MDP1 acetate, a Melittin peptide, damages bacterial membranes and kills MDR S. aureus, E. coli, and P. aeruginosa.</p>Formula:C113H206N34O30Color and Shape:SolidMolecular weight:2521.05a-Helical Corticotropin Releasing Factor (12-41)
CAS:<p>α-Helical CRF (12-41), a 30-aa analog, curbs CRF's ACTH-stimulating effect.</p>Formula:C152H251N43O47S2Color and Shape:SolidMolecular weight:3497.01[Lys5,MeLeu9,Nle10]Neurokinin A(4-10)
CAS:<p>'[Lys5,MeLeu9,Nle10]Neurokinin A(4-10)' is a selective NK2R agonist with prokinetic activity for smooth muscle studies.</p>Formula:C39H64N8O10Color and Shape:SolidMolecular weight:804.97Danshenxinkun B
CAS:<p>Danshenxinkun B has antioxIdant activity, it may have the potential of being used as natural antioxidants in foods and cosmetics.</p>Formula:C18H16O3Purity:98%Color and Shape:SolidMolecular weight:280.32Mca-VDQVDGW-Lys(Dnp)-NH2
<p>Mca-VDQVDGW-Lys(Dnp)-NH2, a fluorogenic substrate specific to caspase-7, facilitates the quantification of caspase-7 activity.</p>Formula:C60H74N14O21Color and Shape:SolidMolecular weight:1327.31Antagonist G TFA
<p>Potent vasopressin blocker, Antagonist G TFA also mildly inhibits GRP & Bradykinin, triggers AP-1, enhances chemo response.</p>Formula:C51H67F3N12O8SColor and Shape:SolidMolecular weight:1065.21Cortistatin 29
<p>Cortistatin 29: neuropeptide, relieves neuropathic pain, binds SS receptors (IC50: 2.8-13.7 nM), anti-fibrotic.</p>Formula:C161H242N46O41S2Color and Shape:SolidMolecular weight:3539.77Calcitonin Gene Related Peptide (CGRP) II, rat TFA
<p>Rat CGRP II TFA: potent vasodilator and CGRP receptor activator for cardiovascular research.</p>Formula:C165H268F3N51O52S2Color and Shape:SolidMolecular weight:3919.33GP120, HIV-1 MN
<p>GP120, HIV-1 MN, a peptide, is utilized in researching HIV infection [1] [2].</p>Formula:C135H221N45O33Color and Shape:SolidMolecular weight:3002.5[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH
CAS:<p>[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH is a synthetic LHRH analog and a GnRH receptor antagonist.</p>Formula:C67H84N16O13Color and Shape:SolidMolecular weight:1321.48Antioxidant agent-9
CAS:<p>Antioxidant agent-9, a peptide (Asp-Trp), shows antioxidant and similar SARS-CoV-2 antiviral strength to Chloroquine and Favipiravir.</p>Formula:C15H17N3O5Color and Shape:SolidMolecular weight:319.31Cenderitide
CAS:<p>Cenderitide fuses CNP with DNP, stimulates pGC-A/B, ups cGMP, curbs aldosterone, and aids GFR, not affecting BP—used in heart failure studies.</p>Formula:C158H263N49O50S3Color and Shape:SolidMolecular weight:3745.27Chemerin-9, Mouse
CAS:<p>Chemokine-like receptor 1 (CMKLR1) agonist (EC50 = 42 nM). Corresponds to C-terminal of full length mouse Chemerin, amino acids 148 - 156.</p>Formula:C51H68N10O12Color and Shape:SolidMolecular weight:1013.163ent-14,15-Dinor-13-oxolabda-8(17),11-dien-18-oic acid
CAS:<p>ent-14,15-Dinor-13-oxolabda-8(17),11-dien-18-oic acid is a natural product of Chloranthus, Chloranthaceae.</p>Formula:C18H26O3Purity:98%Color and Shape:SolidMolecular weight:290.4Z-FG-NHO-Bz
CAS:<p>Z-FG-NHO-Bz is a selective inhibitor of cathepsin [1].</p>Formula:C26H25N3O6Color and Shape:SolidMolecular weight:475.49MCH(human, mouse, rat) TFA
<p>MCH TFA, a peptide, selectively binds MCH1R and MCH2R with IC50 of 0.3nM, 1.5nM; EC50s are 3.9nM (MCH1R) and 0.1nM (MCH2R) in CHO cells.</p>Formula:C107H161F3N30O28S4Color and Shape:SolidMolecular weight:2500.86USP8-IN-2
CAS:<p>USP8-IN-2 is a potent inhibitor of the deubiquitinating enzymes USP7 and USP8, with an IC50 of 4.0 μM against USP8D.</p>Formula:C19H20ClF3N4OSPurity:99.92%Color and Shape:SolidMolecular weight:444.9Urocortin III (human)
CAS:<p>Urocortin III, a human peptide, binds CRF-R2, affecting insulin via somatostatin feedback with K i values 13.5-100+ nM.</p>Formula:C185H307N53O50S2Color and Shape:SolidMolecular weight:4137.9315,16-Epoxy-12S-hydroxylabda-8(17),13(16),14-triene
CAS:<p>15,16-Epoxy-12S-hydroxylabda-8(17),13(16),14-triene is a natural product for research related to life sciences.</p>Formula:C20H30O2Purity:98%Color and Shape:SolidMolecular weight:302.458-Lavandulylkaempferol
CAS:<p>8-Lavandulylkaempferol exhibits significant inhibitory effects with IC(50) values of 7.10 and 8.11 microM for butyrylcholinesterase and acetylcholinesterase,</p>Formula:C25H26O6Purity:98%Color and Shape:SolidMolecular weight:422.47(Phe2,Orn8)-Oxytocin
CAS:<p>(Phe2,Orn8)-Oxytocin: Selective V1 agonist, induces rabbit epididymis contractility, EC50=280 nM.</p>Formula:C42H65N13O11S2Color and Shape:SolidMolecular weight:992.18
![[Lys5,MeLeu9,Nle10]Neurokinin A(4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76426.webp&w=3840&q=75)
![[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76350.webp&w=3840&q=75)
