Amino Acids (AA)

<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>

<p>Please enquire for more information about Z-Gly-Pro-Phe-Pro-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys</p>

<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>

<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-Pepstatin is a protein data inhibitor that binds to the active site of enzymes, inhibiting their function. Acetyl-pepstatin has been shown to inhibit cathepsin D, chymotrypsin, and trypsin. It also inhibits the activity of proteases in the stomach and intestinal tract. Acetyl-Pepstatin is used as an anti-inflammatory drug for the treatment of chronic obstructive pulmonary disease (COPD) and congestive heart failure (CHF). The inhibition of these enzymes reduces inflammation by preventing the activation of inflammatory cytokines. It also prevents collagen from being degraded by proteases, which leads to decreased degradation of cartilage by chondrocytes. This drug's mechanism is similar to that of acetylsalicylic acid (aspirin), in that it inhibits prostaglandin synthesis.br&gt;</p>

<p>Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>

<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>

<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-4-N-Boc-2-hydroxymethyl-piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N2,N6-Bis-cbz-L-lysine is a synthetic acid transporter that is used to inhibit the transport of lysine across the cell membrane. It is an amide, which can be synthesized from lysine and benzoyl chloride. This compound has been shown to have an inhibitory effect on tumor growth in vitro and in vivo. N2,N6-Bis-cbz-L-lysine is active when targeting acidic environments such as tumors. The carbonyl group of this molecule reacts with the hydroxyl group at C4′ on the ribose ring of nucleosides to form a 1,2 diol moiety. This reaction leads to inhibition of DNA synthesis by preventing RNA polymerase from binding to DNA.</p>

<p>H-Ser-Asp-Gly-Arg-Gly-OH is a peptide and model system for epidermal growth factor. It has been shown to stimulate epidermal growth and protein synthesis in the skin cells. The peptide has also been shown to inhibit fibrinogen production by monoclonal antibody, which is a biochemical marker of wound healing. H-Ser-Asp-Gly-Arg-Gly-OH analogs have been shown to inhibit the activation of epidermal growth factor receptor and have an inhibitory effect on cell growth.</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-inflammatory peptide 2 (AIP2) is a small peptide that has been shown to have anti-inflammatory activity. AIP2 inhibits the production of inflammatory mediators such as prostaglandins and leukotrienes. The synthesis of AIP2 is regulated by a hydroxyl group, which may be important for its therapeutic use. AIP2 does not have any side effects and can be used in the treatment of inflammation. <br>The active form of AIP2 is generated from the amino acid sequence H-His-Asp-Met-Asn-Lys-Val-Leu-Asp-Leu. It has been shown that this sequence also inhibits protein synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. <br>The molecular weight of AIP2 is 706 Da and it has two disulfide bonds and two ester linkages. The metal chelate was found to bind with</p>

<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>

<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>

<p>N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is a chiral, electron deficient reagent that reacts with aldehydes and boronic esters to form products with high chemical yields. This compound can be used as a catalyst for acylation reactions, such as the synthesis of p-nitrophenol. N-Methoxymethyl-N-(trimethylsilylmethyl)benzylamine is synthesized by the reaction of trifluoroacetic acid and an amine, followed by chloroformate displacement. The product is then reacted with acylating agents in the presence of catalysts.</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>

<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>

<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>

<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>

<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>

<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>

<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>

<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>

<p>Boc-cys(Npys)-oh is an active substance that inhibits the growth of mouse tumors and has been shown to inhibit a number of different biological processes. It is a cross-linking agent for amino acids and has been shown to have an inhibitory effect on the synthesis of proteins by blocking the formation of disulfide bonds. This compound belongs to the class of chemicals known as sulfonamides, which are used in the treatment of bacterial infections. Boc-cys(Npys)-oh also specifically binds to antigen sites on cells, inhibiting their growth, and can be used as an antitumor agent. The molecule can be chemically linked with other molecules such as trifluoroacetic acid (TFA), resulting in a product with different properties than those found in Boc-cys(Npys)-oh. The chemical ligation process is used to produce subcutaneous tumors in mice that are then treated with hydrogen fluoride (</p>

<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Met-enkephalin is a molecule that is formed from two of the three parts of the endorphin molecule, which are Tyr-Gly-Gly-Phe and Met(O)OH. It is a neurotransmitter that has been shown to inhibit pain in humans and animals. In coelomocytes, met-enkephalin binds to receptors on the cell membrane and inhibits the release of dopamine by binding to dopamine receptors. The sulfoxide group of this molecule can be reduced to form enkephalinase, which is an enzyme that cleaves Met(O)OH from the peptide chain. This process is not known to occur in humans or other mammals. Met-enkephalin has been localized in ganglia cells in animals, but not humans. It has also been found in messenger RNA (mRNA) for translation into protein, but it does not appear to be translated into protein in humans or other mammals.</p>

<p>Please enquire for more information about H-Gly-Gly-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-3,5-dinitro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sarafotoxin A is a low potency β-amino acid analog that inhibits the inflammatory activity of endothelin-A. It has been shown to inhibit the production of reactive oxygen species, which may be due to its inhibition of fatty acid synthesis. Sarafotoxin A also has diagnostic properties and can be used in the diagnosis of inflammatory diseases.</p>

<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>

<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-alpha-Fmoc-Ndelta-allyloxycarbonyl-L-ornithine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Bromo-5-methylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>

<p>Please enquire for more information about Z-Asp-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>

<p>Please enquire for more information about (2-{Ethyl-[4-(4-nitro-phenylazo)-phenyl]-amino}-ethoxy)-acetic acid-4-nitro-phenyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-alpha,epsilon-bis-Z-L-Lysine N-hydroxysuccinimide ester is a methyl ester of the amino acid Lysine. This drug has been shown to have antinociceptive effects in animal models and may be useful for the treatment of inflammatory pain. The active conformation of this drug is dependent on the presence of hydroxybenzimidazole (HOBt). In the absence of HOBt, the compound does not have any activity. Acetylation or amidation may also affect its activity. The reaction with nitric acid yields a nitro derivative, which can be reduced back to the original compound by catalytic hydrogenation using palladium on carbon. A carboxylic acid group at the amino terminus can be converted to an amide or amido group by treatment with an appropriate reagent such as acetonitrile. This drug binds to a catalytic site on</p>

<p>Boc-Phe-Tyr-OH is a pancreatic enzyme that has been shown to be stable in the presence of buffers and tissues. It is used for the treatment of cancer and pancreatic diseases, such as cystic fibrosis and diabetes. Boc-Phe-Tyr-OH has been shown to have high uptake rates in caco-2 cells, which are human intestinal cells that are used to study drug transport. This compound also has an inhibitory effect on cell proliferation and DNA synthesis.</p>

<p>Please enquire for more information about Ac-Val-Tyr-Leu-Lys-Ala-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 2-amino-5-methylbenzoate is a chemical substance that is a precursor for the synthesis of picolinic acid. It also has an antitumor activity against various cancer cell lines and microcapsules. In addition, methyl 2-amino-5-methylbenzoate can be used as a reagent in the preparation of amines and sample preparation. The chemical reactions of methyl 2-amino-5-methylbenzoate are catalyzed by hydrochloric acid and sulfamoyl chloride. This chemical substance reacts with carbonyl groups to form nitro compounds.</p>